| Clone Name | baal36b08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TNKS1_HUMAN (O95271) Tankyrase 1 (EC 2.4.2.30) (TANK1) (Tankyras... | 31 | 2.6 | 2 | AIR12_ARATH (Q94BT2) Auxin-induced in root cultures protein 12 p... | 30 | 4.4 |
|---|
>TNKS1_HUMAN (O95271) Tankyrase 1 (EC 2.4.2.30) (TANK1) (Tankyrase I) (TNKS-1)| (TRF1-interacting ankyrin-related ADP-ribose polymerase) Length = 1327 Score = 30.8 bits (68), Expect = 2.6 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = -2 Query: 452 LVILNATMPYGHATNLAVLCIQGISTVAQSSWNYT 348 L+ L+ +GHA +++L QG A+ +WNYT Sbjct: 250 LIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYT 284
>AIR12_ARATH (Q94BT2) Auxin-induced in root cultures protein 12 precursor| Length = 252 Score = 30.0 bits (66), Expect = 4.4 Identities = 12/43 (27%), Positives = 26/43 (60%) Frame = -2 Query: 470 FDSCTRLVILNATMPYGHATNLAVLCIQGISTVAQSSWNYTQW 342 FDSC L +LN+ + Y + ++ + L + ++T +Q++ + W Sbjct: 40 FDSCEDLPVLNSYLHYTYNSSNSSLSVAFVATPSQANGGWVAW 82 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,443,289 Number of Sequences: 219361 Number of extensions: 1293989 Number of successful extensions: 1672 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1652 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1672 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4373119116 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)