| Clone Name | baal34n11 |
|---|---|
| Clone Library Name | barley_pub |
>ICAM1_MOUSE (P13597) Intercellular adhesion molecule 1 precursor (ICAM-1)| (MALA-2) Length = 537 Score = 30.4 bits (67), Expect = 4.8 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = +2 Query: 452 CYHGEVPVESGGTRLPTVVSFPNTSSARSSP*WPRIYPSLLIQCNI 589 C+ V+S + TV SFP + R P W ++ L ++C++ Sbjct: 91 CFENCGTVQSSASATITVYSFPESVELRPLPAWQQVGKDLTLRCHV 136
>SAMD4_HUMAN (Q9UPU9) Sterile alpha motif domain-containing protein 4| Length = 529 Score = 30.0 bits (66), Expect = 6.2 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +2 Query: 431 WVIHSAGCYHGEVPVESGGTRLPTVVSFPNTSSARSSP*W 550 W S GC +G VP+ S + +PT ++ TS++ + P W Sbjct: 104 WQDKSMGCENGHVPLYSSSS-VPTTINTIGTSTSTNVPAW 142
>YL585_MIMIV (Q5UP53) Hypothetical protein L585| Length = 107 Score = 29.6 bits (65), Expect = 8.1 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -2 Query: 144 SLLLAPAAGRDREGDE*SVDWGDGRVVGAA 55 SLL+APA R G S WG GR V AA Sbjct: 72 SLLVAPAIYRAGSGPVGSTPWGSGRQVNAA 101
>MT_PHACO (P68499) Metallothionein (MT) (Fragment)| Length = 49 Score = 29.6 bits (65), Expect = 8.1 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 121 RCRSEQQACCPVILSGSPNGCSRSCLC 201 RCRS +++CC +G N C++ C+C Sbjct: 12 RCRSCRKSCCSCCPAGC-NNCAKGCVC 37
>MT_MELGA (P68498) Metallothionein (MT)| Length = 63 Score = 29.6 bits (65), Expect = 8.1 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 121 RCRSEQQACCPVILSGSPNGCSRSCLC 201 RCRS +++CC +G N C++ C+C Sbjct: 26 RCRSCRKSCCSCCPAGC-NNCAKGCVC 51
>MT_CHICK (P68497) Metallothionein (MT)| Length = 63 Score = 29.6 bits (65), Expect = 8.1 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 121 RCRSEQQACCPVILSGSPNGCSRSCLC 201 RCRS +++CC +G N C++ C+C Sbjct: 26 RCRSCRKSCCSCCPAGC-NNCAKGCVC 51
>MT_CAIMO (P68495) Metallothionein (MT)| Length = 63 Score = 29.6 bits (65), Expect = 8.1 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 121 RCRSEQQACCPVILSGSPNGCSRSCLC 201 RCRS +++CC +G N C++ C+C Sbjct: 26 RCRSCRKSCCSCCPAGC-NNCAKGCVC 51
>MT_ANAPL (P68494) Metallothionein (MT)| Length = 63 Score = 29.6 bits (65), Expect = 8.1 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 121 RCRSEQQACCPVILSGSPNGCSRSCLC 201 RCRS +++CC +G N C++ C+C Sbjct: 26 RCRSCRKSCCSCCPAGC-NNCAKGCVC 51
>MTA_COLVI (P27086) Metallothionein A (MTA) (Fragment)| Length = 43 Score = 29.6 bits (65), Expect = 8.1 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 121 RCRSEQQACCPVILSGSPNGCSRSCLC 201 RCRS +++CC +G N C++ C+C Sbjct: 12 RCRSCRKSCCSCCPAGC-NNCAKGCVC 37
>ATR_XENLA (Q9DE14) Serine/threonine-protein kinase atr (EC 2.7.11.1) (Ataxia| telangiectasia and Rad3-related protein) (Xatr) Length = 2654 Score = 29.6 bits (65), Expect = 8.1 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 4/35 (11%) Frame = +3 Query: 105 LPYPYPLQERAT----SLLPRHPLWFSQWVQQELP 197 LP PLQE+ +LLPRHP F +W + P Sbjct: 2421 LPKSAPLQEKLKVFKEALLPRHPPLFHEWFLRTFP 2455 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 98,625,083 Number of Sequences: 219361 Number of extensions: 2236882 Number of successful extensions: 7183 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 6821 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7175 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6143359464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)