| Clone Name | baal34n10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RS29_SPOFR (Q8WQI3) 40S ribosomal protein S29 | 35 | 0.17 | 2 | RS29_GRIJA (Q7XYB0) 40S ribosomal protein S29 | 33 | 0.84 | 3 | RS29_DROME (Q9VH69) 40S ribosomal protein S29 | 33 | 0.84 | 4 | RS29_CULQU (Q9NB51) 40S ribosomal protein S29 | 32 | 2.4 | 5 | OBPA_CANAL (Q9UW25) Oxysterol-binding protein-like protein OBPa | 32 | 2.4 | 6 | CRTY_ENTAG (Q01331) Lycopene cyclase | 31 | 3.2 | 7 | RS29_SCHPO (O74329) 40S ribosomal protein S29 | 31 | 4.2 | 8 | RS29A_YEAST (P41057) 40S ribosomal protein S29-A (S36) (YS29) | 31 | 4.2 | 9 | HEM1_GLOVI (Q7NLA8) Glutamyl-tRNA reductase (EC 1.2.1.70) (GluTR) | 31 | 4.2 |
|---|
>RS29_SPOFR (Q8WQI3) 40S ribosomal protein S29| Length = 56 Score = 35.4 bits (80), Expect = 0.17 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = +2 Query: 86 GYSNVWNSHPKNYGPGSRVW*APTARH 166 G++N+W SHP+ YG GSR A + RH Sbjct: 2 GHANIWYSHPRRYGQGSRSCRACSNRH 28
>RS29_GRIJA (Q7XYB0) 40S ribosomal protein S29| Length = 56 Score = 33.1 bits (74), Expect = 0.84 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 Query: 86 GYSNVWNSHPKNYGPGSR 139 G+ N+W SHP+ YG GSR Sbjct: 2 GHQNIWYSHPRKYGKGSR 19
>RS29_DROME (Q9VH69) 40S ribosomal protein S29| Length = 56 Score = 33.1 bits (74), Expect = 0.84 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +2 Query: 86 GYSNVWNSHPKNYGPGSRVW*APTARH 166 G++ +W SHP+ YG GSR A + RH Sbjct: 2 GFATLWYSHPRKYGQGSRCCRACSNRH 28
>RS29_CULQU (Q9NB51) 40S ribosomal protein S29| Length = 56 Score = 31.6 bits (70), Expect = 2.4 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +2 Query: 86 GYSNVWNSHPKNYGPGSRVW*APTARH 166 G++++W SHP+ YG GSR A + H Sbjct: 2 GFADLWYSHPRKYGQGSRFCRACSNNH 28
>OBPA_CANAL (Q9UW25) Oxysterol-binding protein-like protein OBPa| Length = 433 Score = 31.6 bits (70), Expect = 2.4 Identities = 15/55 (27%), Positives = 26/55 (47%) Frame = -1 Query: 479 LKLASTTSRQHQISMHTINS*QTDEKADLDYPDKSHQAAVTKQLVKLTPSIDAPR 315 LKL T + + + +N TD+ D+D D Q+ + + +L P +D R Sbjct: 10 LKLKELTGHEAAVKSNVVNGADTDDTDDIDEMDNEGQSILMGIIAQLRPGMDLSR 64
>CRTY_ENTAG (Q01331) Lycopene cyclase| Length = 386 Score = 31.2 bits (69), Expect = 3.2 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +2 Query: 71 SGEDDGYSNVWNSHPKNYGPGSRVW*APTARHNSP 175 +GE G ++ W+ H + PG W AP H P Sbjct: 34 AGEQPGGNHTWSFHEDDLTPGQHAWLAPLVAHAWP 68
>RS29_SCHPO (O74329) 40S ribosomal protein S29| Length = 55 Score = 30.8 bits (68), Expect = 4.2 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +2 Query: 89 YSNVWNSHPKNYGPGSR 139 + NVW SHP+ YG GSR Sbjct: 2 HENVWFSHPRKYGKGSR 18
>RS29A_YEAST (P41057) 40S ribosomal protein S29-A (S36) (YS29)| Length = 55 Score = 30.8 bits (68), Expect = 4.2 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +2 Query: 89 YSNVWNSHPKNYGPGSR 139 + NVW SHP+ YG GSR Sbjct: 2 HENVWFSHPRRYGKGSR 18
>HEM1_GLOVI (Q7NLA8) Glutamyl-tRNA reductase (EC 1.2.1.70) (GluTR)| Length = 430 Score = 30.8 bits (68), Expect = 4.2 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = -3 Query: 594 LLSTLNLAYQLALEVNIKGNRHGLKHQTQFLAEKGKVQLKTCKHH 460 +LST N +L + ++ + HGL+ T+FLAE V L T + H Sbjct: 46 ILSTCN---RLEIYTVLRDSEHGLREVTRFLAESKGVLLPTLQRH 87 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,280,802 Number of Sequences: 219361 Number of extensions: 1843433 Number of successful extensions: 4160 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 4027 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4160 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7026286028 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)