| Clone Name | baal34k21 |
|---|---|
| Clone Library Name | barley_pub |
>PICO_DROME (Q9V7S5) Putative inorganic phosphate cotransporter| Length = 529 Score = 28.9 bits (63), Expect = 5.1 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -3 Query: 116 FRTWVHQDPSCHPTLSPKADQALTGSL 36 F +VH+DPS HPT+ + + + SL Sbjct: 248 FLIFVHEDPSSHPTIDEREKKYINDSL 274
>SUFS_WIGBR (Q8D2J7) Cysteine desulfurase (EC 2.8.1.7) (Selenocysteine lyase)| (EC 4.4.1.16) (Selenocysteine reductase) (Selenocysteine beta-lyase) (SCL) Length = 410 Score = 28.9 bits (63), Expect = 5.1 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = -2 Query: 363 ICTYINSDLENEVYLVALTCANHTFPSTGTSETFLLEQDQMGIQIMEHH 217 I +IN+ ++E+ V T + ETF+ + D + I MEHH Sbjct: 76 IAKFINAKSDSEIIFVKGTTEGINLVANTWGETFIKKGDNIVITQMEHH 124
>KCRU_MOUSE (P30275) Creatine kinase, ubiquitous mitochondrial precursor (EC| 2.7.3.2) (U-MtCK) (Mia-CK) (Acidic-type mitochondrial creatine kinase) Length = 418 Score = 28.9 bits (63), Expect = 5.1 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 21 SSTLPQRPGQRLVSLG*EGGMTRGVLMDPST 113 S L RPG RL++L G +T G+L+ P + Sbjct: 6 SRLLSARPGLRLLALAGAGSLTAGILLRPES 36
>HHEX_MOUSE (P43120) Homeobox protein PRH (Hematopoietically expressed| homeobox) (Homeobox protein HEX) Length = 271 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -3 Query: 146 NNGFKHLITGFRTWVHQDPSCHPTLSPKADQALTGSLGKS 27 N+ F L++ +RT V++ HP S AL + G S Sbjct: 56 NSSFTSLVSSYRTPVYEPTPVHPAFSHHPAAALAAAYGPS 95
>YXWK_CAEEL (Q21184) Putative cuticle collagen F55C10.3| Length = 266 Score = 28.1 bits (61), Expect = 8.8 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +2 Query: 11 G*PEQHSSPETRSAPGQPWVRGWDDKRGLDGPKYGN 118 G P +P + PGQP G D + G GPK N Sbjct: 183 GAPGPQGTPGPQGPPGQPGQPGHDGQPGAPGPKGPN 218 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,138,005 Number of Sequences: 219361 Number of extensions: 1221086 Number of successful extensions: 2976 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2584 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2974 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)