| Clone Name | baal34k17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RPA1_SCHPO (P15398) DNA-directed RNA polymerase I 190 kDa polype... | 33 | 0.76 |
|---|
>RPA1_SCHPO (P15398) DNA-directed RNA polymerase I 190 kDa polypeptide (EC| 2.7.7.6) Length = 1689 Score = 33.1 bits (74), Expect = 0.76 Identities = 20/66 (30%), Positives = 29/66 (43%) Frame = +1 Query: 67 PHEWSSQPENTSETGALISARPVTFTIRTGEAGSAAVAVYNLLAKLQLSFLYVIGLIVMG 246 PH+W +E G LIS P+T RT A NL++ S+ +I Sbjct: 535 PHKWPGASHIQNEDGTLISLMPLTIEQRTALANQLLTPQSNLISS-PYSYSRLINTNKKV 593 Query: 247 FEHMRN 264 + H+RN Sbjct: 594 YRHVRN 599 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 92,331,973 Number of Sequences: 219361 Number of extensions: 1824058 Number of successful extensions: 4363 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4217 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4362 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6314008338 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)