| Clone Name | baal34j09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PPBJ_RAT (P51740) Intestinal alkaline phosphatase 2 precursor (E... | 30 | 3.4 | 2 | FOG1_HUMAN (Q8IX07) Zinc finger protein ZFPM1 (Zinc finger prote... | 29 | 7.6 | 3 | REPS1_MOUSE (O54916) RalBP1-associated Eps domain-containing pro... | 29 | 9.9 |
|---|
>PPBJ_RAT (P51740) Intestinal alkaline phosphatase 2 precursor (EC 3.1.3.1)| (IAP-II) Length = 551 Score = 30.4 bits (67), Expect = 3.4 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 7/55 (12%) Frame = -1 Query: 529 VFSSGTELESLH--KERNYFA*-----GTLRSYSSLQRAPPAVQHRPLIFQENAT 386 +F+ G + LH +E+NY A G L Y+ APPA ++RP +N+T Sbjct: 457 IFARGPQAHLLHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPADENRPTTPVQNST 511
>FOG1_HUMAN (Q8IX07) Zinc finger protein ZFPM1 (Zinc finger protein multitype| 1) (Friend of GATA protein 1) (Friend of GATA-1) (FOG-1) Length = 1004 Score = 29.3 bits (64), Expect = 7.6 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = -1 Query: 121 DEASDAEHPKADP--LRAPPGHAALPDVHLDGEVDGERPE 8 ++A A PKA P RAPPG A PD G R E Sbjct: 605 EDAPAARRPKAPPGPARAPPGQPAEPDAPRSSPGPGAREE 644
>REPS1_MOUSE (O54916) RalBP1-associated Eps domain-containing protein 1| (RalBP1-interacting protein 1) Length = 743 Score = 28.9 bits (63), Expect = 9.9 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -1 Query: 127 GHDEASDAEHPKADPLRAPPGHAALPDVHLDGEVDG 20 G +A HP A P R P A P VH + DG Sbjct: 521 GQQQAGVVAHPPAVPPRPQPSQAPGPSVHRPVDADG 556 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,099,948 Number of Sequences: 219361 Number of extensions: 1448183 Number of successful extensions: 3431 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3365 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3429 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4373119116 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)