| Clone Name | baal34e13 |
|---|---|
| Clone Library Name | barley_pub |
>PO3F2_MOUSE (P31360) POU domain, class 3, transcription factor 2 (Nervous| system-specific octamer-binding transcription factor N-Oct-3) (Brain-specific homeobox/POU domain protein 2) (Brain-2) (Protein Brn-2) Length = 445 Score = 32.3 bits (72), Expect = 0.80 Identities = 19/65 (29%), Positives = 30/65 (46%) Frame = +2 Query: 8 EEFGRGDDLPGPPSYASQRRRHGSGAQDRQREPLQGDFLRRQRAQHSGRQANWPPHGAGW 187 ++ GRGD+L GP + Q ++ Q +Q++ Q Q+ Q R + H A Sbjct: 110 QQGGRGDELHGPGALQQQHQQQQQQQQQQQQQQQQ------QQQQQQQRPPHLVHHAANH 163 Query: 188 HVTPG 202 H PG Sbjct: 164 HPGPG 168
>KR10C_HUMAN (P60413) Keratin-associated protein 10-12 (Keratin-associated| protein 10.12) (High sulfur keratin-associated protein 10.12) (Keratin-associated protein 18-12) (Keratin-associated protein 18.12) Length = 245 Score = 31.6 bits (70), Expect = 1.4 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -3 Query: 195 VTCQPAPC--GGQFACLPECCARCRRRKSPCKGS 100 VTC+P+PC G +C P CC + + + C S Sbjct: 65 VTCEPSPCQSGCTSSCTPSCCQQSSCQPACCTSS 98
>KR109_HUMAN (P60411) Keratin-associated protein 10-9 (Keratin-associated| protein 10.9) (High sulfur keratin-associated protein 10.9) (Keratin-associated protein 18-9) (Keratin-associated protein 18.9) Length = 292 Score = 31.6 bits (70), Expect = 1.4 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -3 Query: 195 VTCQPAPC--GGQFACLPECCARCRRRKSPCKGS 100 VTC+P+PC G +C P CC + + + C S Sbjct: 60 VTCEPSPCQSGCTSSCTPSCCQQSSCQPAYCTSS 93
>PO3F2_RAT (P56222) POU domain, class 3, transcription factor 2 (Nervous| system-specific octamer-binding transcription factor N-Oct-3) (Brain-specific homeobox/POU domain protein 2) (Brain-2) (Protein Brn-2) Length = 445 Score = 31.6 bits (70), Expect = 1.4 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 2/60 (3%) Frame = +2 Query: 8 EEFGRGDDLPGPPSYASQRRRHGSGAQDRQREPLQGDFLRRQRAQHSGRQA--NWPPHGA 181 ++ GRGD+L GP + Q ++ Q +Q++ Q ++QR H A N P GA Sbjct: 110 QQGGRGDELHGPGALQQQHQQQQQQQQQQQQQQQQQQQQQQQRPPHLVHHAANNHPGPGA 169
>KR107_HUMAN (P60409) Keratin-associated protein 10-7 (Keratin-associated| protein 10.7) (High sulfur keratin-associated protein 10.7) (Keratin-associated protein 18-7) (Keratin-associated protein 18.7) Length = 370 Score = 31.2 bits (69), Expect = 1.8 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -3 Query: 195 VTCQPAPC--GGQFACLPECCARCRRRKSPCKGS 100 VTC+P+PC G +C P CC + + + C S Sbjct: 70 VTCEPSPCQSGCTSSCTPSCCQQSSCQLACCASS 103
>KR104_HUMAN (P60372) Keratin-associated protein 10-4 (Keratin-associated| protein 10.4) (High sulfur keratin-associated protein 10.4) (Keratin-associated protein 18-4) (Keratin-associated protein 18.4) Length = 401 Score = 31.2 bits (69), Expect = 1.8 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -3 Query: 195 VTCQPAPC--GGQFACLPECCARCRRRKSPCKGS 100 VTC+P+PC G +C P CC + + + C S Sbjct: 70 VTCEPSPCQSGCTSSCTPSCCQQSSCQLACCASS 103
>KR106_HUMAN (P60371) Keratin-associated protein 10-6 (Keratin-associated| protein 10.6) (High sulfur keratin-associated protein 10.6) (Keratin-associated protein 18-6) (Keratin-associated protein 18.6) Length = 365 Score = 31.2 bits (69), Expect = 1.8 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -3 Query: 195 VTCQPAPC--GGQFACLPECCARCRRRKSPCKGS 100 VTC+P+PC G +C P CC + + + C S Sbjct: 70 VTCEPSPCQSGCTSSCTPSCCQQSSCQLACCASS 103
>PO3F2_HUMAN (P20265) POU domain, class 3, transcription factor 2 (Nervous| system-specific octamer-binding transcription factor N-Oct-3) (Brain-specific homeobox/POU domain protein 2) (Brain-2) (Protein Brn-2) Length = 443 Score = 31.2 bits (69), Expect = 1.8 Identities = 21/69 (30%), Positives = 30/69 (43%), Gaps = 4/69 (5%) Frame = +2 Query: 8 EEFGRGDDLPGPPSYASQRRRHGSGAQDRQREPLQGDFLRRQRAQHSGRQANWPP----H 175 ++ GRGD+L HG GA +Q + Q ++Q+ Q +Q PP H Sbjct: 110 QQGGRGDEL------------HGPGALQQQHQQQQQQQQQQQQQQQQQQQQQRPPHLVHH 157 Query: 176 GAGWHVTPG 202 A H PG Sbjct: 158 AANHHPGPG 166
>SSM1_YEAST (P53078) Protein SSM1| Length = 280 Score = 30.8 bits (68), Expect = 2.3 Identities = 20/61 (32%), Positives = 34/61 (55%), Gaps = 1/61 (1%) Frame = +3 Query: 3 GLRNSDEATTCXDPRPMQANVGAMEAALRIANVNPYK-AIFFDDSVRNIQAGKRIGLHTV 179 GL D + T D + +V A E A++ + + Y+ A F DDS +NI+ G ++G+ T Sbjct: 187 GLTYCDYSRT--DTLVCKPHVKAFEKAMKESGLARYENAYFIDDSGKNIETGIKLGMKTC 244 Query: 180 L 182 + Sbjct: 245 I 245
>GMHB_CHLTE (Q8KAY7) D,D-heptose 1,7-bisphosphate phosphatase (EC 3.1.3.-)| (D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase) Length = 199 Score = 30.4 bits (67), Expect = 3.0 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +3 Query: 114 AIFFDDSVRNIQAGKRIGLHTVLVGTSHPGEGRGSRAGEHPQH 242 + F D + +++ G+R GL T+LV T H E + P H Sbjct: 136 SFFIGDKLIDVECGQRAGLKTILVRTGHNEESLCEQHQIFPDH 178
>KR105_HUMAN (P60370) Keratin-associated protein 10-5 (Keratin-associated| protein 10.5) (High sulfur keratin-associated protein 10.5) (Keratin-associated protein 18-5) (Keratin-associated protein 18.5) Length = 271 Score = 30.4 bits (67), Expect = 3.0 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = -3 Query: 189 CQPAPC--GGQFACLPECCARCRRRKSPCK 106 C+P+PC G +C P CC SPC+ Sbjct: 56 CEPSPCQSGCTSSCTPSCCQPACCASSPCQ 85
>K0355_HUMAN (O15063) Protein KIAA0355| Length = 1070 Score = 30.4 bits (67), Expect = 3.0 Identities = 17/56 (30%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Frame = +2 Query: 38 GPPSYAS--QRRRHGSGAQDRQREPLQGDFLRRQRAQHSGRQANWPPHGAGWHVTP 199 GP A+ QRR+H SG QD P + + WPP H +P Sbjct: 931 GPDLVAAVKQRRKHSSGEQDTSTLPSPPLLTTVEDVNQDNKTKTWPPKAPWQHPSP 986
>ANK3_HUMAN (Q12955) Ankyrin-3 (ANK-3) (Ankyrin-G)| Length = 4377 Score = 30.0 bits (66), Expect = 4.0 Identities = 22/77 (28%), Positives = 33/77 (42%) Frame = +3 Query: 15 SDEATTCXDPRPMQANVGAMEAALRIANVNPYKAIFFDDSVRNIQAGKRIGLHTVLVGTS 194 +DE+T +P P + G M R ++ K F ++ ++ Q IG HT + Sbjct: 3589 TDESTPTSEPNPFPFHEGKMFEMTRSGAIDMSKRDFVEERLQFFQ----IGEHTSEGKSG 3644 Query: 195 HPGEGRGSRAGEHPQHQ 245 GEG S PQ Q Sbjct: 3645 DQGEGDKSMVTATPQPQ 3661
>YIHX_SHIFL (P0A8Y4) Phosphatase yihX (EC 3.1.3.-)| Length = 199 Score = 30.0 bits (66), Expect = 4.0 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +3 Query: 84 LRIANVNPYKAIFFDDSVRNIQAGKRIGLHTVLV 185 L+ +P +FFDD+ NI+ ++G+ ++LV Sbjct: 151 LQAEGFSPSDTVFFDDNADNIEGANQLGITSILV 184
>YIHX_ECOLI (P0A8Y3) Phosphatase yihX (EC 3.1.3.-)| Length = 199 Score = 30.0 bits (66), Expect = 4.0 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +3 Query: 84 LRIANVNPYKAIFFDDSVRNIQAGKRIGLHTVLV 185 L+ +P +FFDD+ NI+ ++G+ ++LV Sbjct: 151 LQAEGFSPSDTVFFDDNADNIEGANQLGITSILV 184
>VE2_HPV45 (P36794) Regulatory protein E2| Length = 368 Score = 29.6 bits (65), Expect = 5.2 Identities = 17/45 (37%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = +3 Query: 384 PQAQPDPTRRPRACRTTGDHH--VEFSIGREKTVSSTRRGELRKV 512 P Q T+RPR C T HH V + SST + RKV Sbjct: 241 PHIQTPATKRPRQCGLTEQHHGRVNTHVHNPLLCSSTSNNKRRKV 285
>SFR17_HUMAN (Q8TF01) Splicing factor, arginine/serine-rich 130| (Serine-arginine-rich splicing regulatory protein 130) (SRrp130) (SR-rich protein) (SR-related protein) Length = 805 Score = 29.6 bits (65), Expect = 5.2 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 35 PGPPSYASQRRRHGSGAQDRQREPL 109 PGPP+ RR S +DRQR P+ Sbjct: 189 PGPPAPPQNRRERPSSFRDRQRSPI 213
>KR108_HUMAN (P60410) Keratin-associated protein 10-8 (Keratin-associated| protein 10.8) (High sulfur keratin-associated protein 10.8) (Keratin-associated protein 18-8) (Keratin-associated protein 18.8) Length = 259 Score = 29.6 bits (65), Expect = 5.2 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -3 Query: 195 VTCQPAPC--GGQFACLPECCARCRRRKSPCKGS 100 V+C+P+PC G +C P CC + + + C S Sbjct: 79 VSCEPSPCQSGCTDSCTPSCCQQSSCQPACCTSS 112
>GMHB_PASMU (Q9CK98) D,D-heptose 1,7-bisphosphate phosphatase (EC 3.1.3.-)| (D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase) Length = 184 Score = 29.3 bits (64), Expect = 6.8 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = +3 Query: 33 CXDPRPMQANVGAMEAALRIANVNPYKAIFFDDSVRNIQAGKRIGL-HTVLVGTSHP 200 C P+P G + A++ N++P + D V ++ AGK + +TVLV T P Sbjct: 105 CRKPKP-----GMLLQAIKELNIDPNTSFMVGDKVEDMLAGKGAKIKNTVLVKTGKP 156
>NIT4_NEUCR (P28349) Nitrogen assimilation transcription factor nit-4| Length = 1090 Score = 28.9 bits (63), Expect = 8.9 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -3 Query: 177 PCGGQFACLPECCARCRRRKSPCKGS 100 P + C+ C CRRRKS C G+ Sbjct: 41 PTNQKRRCVSTACIACRRRKSKCDGA 66
>HAM_DROME (Q8I7Z8) Transcription factor hamlet| Length = 990 Score = 28.9 bits (63), Expect = 8.9 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -3 Query: 228 LQRVIRALHPGVTCQPAP-CGGQF 160 LQR IRA H G C P P CG F Sbjct: 295 LQRHIRAYHVGARCHPCPECGKTF 318
>NIRA_EMENI (P28348) Nitrogen assimilation transcription factor nirA| Length = 892 Score = 28.9 bits (63), Expect = 8.9 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -3 Query: 198 GVTCQPAPCGGQFACLPECCARCRRRKSPCKGS 100 G + AP + C+ C CRRRKS C G+ Sbjct: 24 GTSTDNAPASKR-RCVSTACIACRRRKSKCDGN 55
>CAT8_YEAST (P39113) Regulatory protein CAT8| Length = 1433 Score = 28.9 bits (63), Expect = 8.9 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -3 Query: 192 TCQPAPCGGQFACLPECCARCRRRKSPCKGSR 97 T P P + + C RCR +K+ C G R Sbjct: 53 TASPTPLSTPIYRIAQACDRCRSKKTRCDGKR 84
>CP6G2_DROME (Q9V675) Probable cytochrome P450 6g2 (EC 1.14.-.-) (CYPVIG2)| Length = 519 Score = 28.9 bits (63), Expect = 8.9 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -1 Query: 473 FFPANAEFHVMITSSPAGSGTPGRIGLRLGY 381 F P N + H T P G G G IG R GY Sbjct: 437 FSPENRKLHTPYTYMPFGLGPHGCIGERFGY 467 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,333,043 Number of Sequences: 219361 Number of extensions: 1325126 Number of successful extensions: 5337 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 4979 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5329 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3927707336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)