| Clone Name | baal34a16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MT21_ORYSA (P94029) Metallothionein-like protein type 2 | 36 | 0.077 | 2 | PIGT_MOUSE (Q8BXQ2) GPI transamidase component PIG-T precursor (... | 30 | 4.2 | 3 | SRE27_CAEEL (O62488) Serpentine receptor class epsilon-27 (Prote... | 30 | 7.2 | 4 | SOX14_DROME (P40656) Putative transcription factor SOX-14 | 30 | 7.2 |
|---|
>MT21_ORYSA (P94029) Metallothionein-like protein type 2| Length = 82 Score = 36.2 bits (82), Expect = 0.077 Identities = 20/38 (52%), Positives = 24/38 (63%) Frame = +2 Query: 83 MYPGMDEGVSTTATSSQALVMGVASSKGNGPSFEAAAA 196 MYP M E V+TT Q ++MGVA SKG+ EA AA Sbjct: 25 MYPEMAEEVTTT----QTVIMGVAPSKGHAEGLEAGAA 58
>PIGT_MOUSE (Q8BXQ2) GPI transamidase component PIG-T precursor| (Phosphatidylinositol-glycan biosynthesis, class T protein) (Neuronal development-associated protein 7) Length = 582 Score = 30.4 bits (67), Expect = 4.2 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -2 Query: 567 LHTQEYIYVDKTGKAHEDGTKAVGEAHDNTTQNTVQATRGTY 442 L +Q +YVD TG + ++ T V +T Q+ + TR TY Sbjct: 278 LASQSLVYVDITGYSQDNETLEVSPPPTSTYQDVILGTRKTY 319
>SRE27_CAEEL (O62488) Serpentine receptor class epsilon-27 (Protein sre-27)| Length = 364 Score = 29.6 bits (65), Expect = 7.2 Identities = 16/62 (25%), Positives = 28/62 (45%) Frame = +2 Query: 428 STDYVYVPLVACTVFCVVLSCASPTALVPSSCAFPVLSTYIYSCVCRQ**FGVSVFFFLK 607 ST+ +++P+ F ++ S AL + T+I SC C S+ FFL Sbjct: 163 STNKIFIPIALTVFFQIIAITCSCLALFHKFTIITINGTWIVSCACS------SIVFFLV 216 Query: 608 KK 613 ++ Sbjct: 217 ER 218
>SOX14_DROME (P40656) Putative transcription factor SOX-14| Length = 472 Score = 29.6 bits (65), Expect = 7.2 Identities = 17/63 (26%), Positives = 26/63 (41%) Frame = -2 Query: 282 PSPCVDSTDHLQVHGLQVQLGPHLHPPFSAAAASNEGPLPLEDATPMTRAWEEVAVVLTP 103 P+P DST PH PPFS + + P P TP + + A + P Sbjct: 42 PAPKADST-------------PHTLPPFSPSPSPASSPSPAPAQTPGAQKTQSQAAITHP 88 Query: 102 SSI 94 +++ Sbjct: 89 AAV 91 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,623,302 Number of Sequences: 219361 Number of extensions: 1299702 Number of successful extensions: 3763 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3622 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3762 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5481822624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)