| Clone Name | baal33l11 |
|---|---|
| Clone Library Name | barley_pub |
>COG2_HUMAN (Q14746) Conserved oligomeric Golgi complex component 2 (Low| density lipoprotein receptor defect C-complementing protein) Length = 738 Score = 29.6 bits (65), Expect = 1.8 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 1/73 (1%) Frame = -2 Query: 226 QCHSQEKCRESSSHGCLHTFTTKENMH*RFKRALDKSAGYTLFWGSLTEEISSSPVHG-H 50 QC SQ + +H H+F K N+ F+ + AG +LT+ + +P + Sbjct: 357 QCGSQASVKRLRAHPAYHSFNKKWNLPVYFQIRFREIAG--SLEAALTDVLEDAPAESPY 414 Query: 49 GLVKSNNRWPSXR 11 L+ S+ W S R Sbjct: 415 CLLASHRTWSSLR 427
>DAOA_HUMAN (P59103) D-amino acid oxidase activator (Protein G72)| Length = 153 Score = 28.9 bits (63), Expect = 3.1 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 2/57 (3%) Frame = -1 Query: 206 MQRIFLTWMPSYLHHKRKHALKVQTRIGQI--CRLYAFLGFSD*GDLVQPGTRAWPC 42 +QR W+ SYL +V + +G++ R Y FL + D QP R W C Sbjct: 77 LQRSLCPWV-SYLPQPYAELEEVSSHVGKVFMARNYEFLAYEASKDRRQPLERMWTC 132
>EGF_PIG (Q00968) Pro-epidermal growth factor precursor (EGF) [Contains:| Epidermal growth factor] Length = 1214 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 113 CRFVQCAFEPSMHVFFCGEGMKASM*GR 196 CR C EP HV C EG S GR Sbjct: 325 CRGSMCGQEPKSHVCTCAEGYTLSQDGR 352
>GBB_NICPL (P93339) Guanine nucleotide-binding protein beta subunit (NpGPB1)| Length = 377 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +2 Query: 77 LLSQRTPEKRIACRFVQ-CAFEPSMHVFFCG 166 L SQ+T ++ C +V CAF PS H CG Sbjct: 95 LTSQKTHAIKLPCAWVMTCAFSPSGHSVACG 125
>YAA3_SCHPO (Q09797) Hypothetical protein C22G7.03 in chromosome I| Length = 236 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/45 (26%), Positives = 24/45 (53%) Frame = -1 Query: 260 LEIYTEVMVNCTMSFTGKMQRIFLTWMPSYLHHKRKHALKVQTRI 126 + I ++ +N T ++ I+ TW+P++ KRK K + R+ Sbjct: 164 IPIIEDISINEDTQRTVSLETIYATWIPTFWESKRKSHEKDEGRL 208
>GLPK2_SULAC (Q4J7A3) Glycerol kinase 2 (EC 2.7.1.30) (ATP:glycerol| 3-phosphotransferase 2) (Glycerokinase 2) (GK 2) Length = 497 Score = 27.7 bits (60), Expect = 7.0 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -3 Query: 354 GSIFSYMLWHQPNGTRYTTVNNLCSRLSSMNIRDL 250 G+I +Y++W NG + T + SR NIR L Sbjct: 162 GTIDTYLIWKLTNGKAHVTDYSNASRTMLFNIRKL 196
>NRDC_RAT (P47245) Nardilysin precursor (EC 3.4.24.61) (N-arginine dibasic| convertase) (NRD convertase) (NRD-C) Length = 1161 Score = 27.3 bits (59), Expect = 9.1 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -2 Query: 379 FFRTQLDRWVNFFIH 335 +F+ LDRW FFIH Sbjct: 293 YFKEALDRWAQFFIH 307
>NRDC_MOUSE (Q8BHG1) Nardilysin precursor (EC 3.4.24.61) (N-arginine dibasic| convertase) (NRD convertase) (NRD-C) Length = 1161 Score = 27.3 bits (59), Expect = 9.1 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -2 Query: 379 FFRTQLDRWVNFFIH 335 +F+ LDRW FFIH Sbjct: 293 YFKEALDRWAQFFIH 307
>AMY_BACST (P06279) Alpha-amylase precursor (EC 3.2.1.1) (1,4-alpha-D-glucan| glucanohydrolase) Length = 549 Score = 27.3 bits (59), Expect = 9.1 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -3 Query: 354 GSIFSYMLWHQPN-GTRYTTVNNLCSRLSSMNIRDL 250 G++ Y W+ P+ GT +T V N + LSS+ I L Sbjct: 40 GTMMQYFEWYLPDDGTLWTKVANEANNLSSLGITAL 75
>NRDC_PONPY (Q5R4H6) Nardilysin precursor (EC 3.4.24.61) (N-arginine dibasic| convertase) (NRD convertase) (NRD-C) Length = 1152 Score = 27.3 bits (59), Expect = 9.1 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -2 Query: 379 FFRTQLDRWVNFFIH 335 +F+ LDRW FFIH Sbjct: 283 YFKEALDRWAQFFIH 297
>NRDC_HUMAN (O43847) Nardilysin precursor (EC 3.4.24.61) (N-arginine dibasic| convertase) (NRD convertase) (NRD-C) Length = 1150 Score = 27.3 bits (59), Expect = 9.1 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -2 Query: 379 FFRTQLDRWVNFFIH 335 +F+ LDRW FFIH Sbjct: 281 YFKEALDRWAQFFIH 295 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,567,179 Number of Sequences: 219361 Number of extensions: 1114301 Number of successful extensions: 2482 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2455 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2482 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 1391514312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)