| Clone Name | baal33f10 |
|---|---|
| Clone Library Name | barley_pub |
>YAAA_SCHPO (Q09801) Hypothetical protein C22G7.10 in chromosome I| Length = 344 Score = 35.0 bits (79), Expect = 0.17 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = +3 Query: 183 TDITSGYKEHSNAANSNQHICKEPSDNPEQSEQPKTEPNI 302 T TSG HS AA N ++ PS + +SE P PNI Sbjct: 233 TTHTSGGGVHSGAATPNAYVNNNPSSSRRESESPANSPNI 272
>CKLF2_HUMAN (Q8TAZ6) CKLF-like MARVEL transmembrane domain-containing protein 2| (Chemokine-like factor superfamily member 2) Length = 248 Score = 30.8 bits (68), Expect = 3.2 Identities = 19/49 (38%), Positives = 24/49 (48%) Frame = +3 Query: 165 PAAMGETDITSGYKEHSNAANSNQHICKEPSDNPEQSEQPKTEPNILKG 311 P A E D G KE S+ KEPSD P+++ QPK E +G Sbjct: 20 PGAKPEEDKKDG-KEPSDKPQKAVQDHKEPSDKPQKAVQPKHEVGTRRG 67
>ESPC_ECO27 (Q9EZE7) Serine protease espC precursor (EC 3.4.21.-)| (EPEC-secreted protein C) Length = 1305 Score = 30.0 bits (66), Expect = 5.4 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = +3 Query: 165 PAAMGETDITSGYKEHSNAANSNQHICKEPSDNPEQSEQPKTEPNILK 308 P + E D SG ++ N+AN N + + ++ EQP E + K Sbjct: 581 PGVICEKDYVSGIQQQENSANKNNNTDYKTNNQVSSFEQPDWENRLFK 628
>SYH_METMP (P60921) Histidyl-tRNA synthetase (EC 6.1.1.21) (Histidine--tRNA| ligase) (HisRS) Length = 416 Score = 26.2 bits (56), Expect(2) = 5.5 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +3 Query: 9 VVPVKSAQPVLVSCRHVDQDVHVEGKSV 92 VVPVKS++ +L C + + + GKSV Sbjct: 331 VVPVKSSEMLLKECLKIAKTLRDSGKSV 358 Score = 22.3 bits (46), Expect(2) = 5.5 Identities = 10/39 (25%), Positives = 22/39 (56%) Frame = +1 Query: 202 TKNTQMLLIATNIFVRNHQITQNSLSNQRQSLTS*KELM 318 TKN + +LI +R+ +++ ++ QSL K+++ Sbjct: 376 TKNIKKVLIVGENDIRDGKVSLKNMETGEQSLIELKDIL 414
>LRP1B_HUMAN (Q9NZR2) Low-density lipoprotein receptor-related protein 1B| precursor (Low-density lipoprotein receptor-related protein-deleted in tumor) (LRP-DIT) Length = 4599 Score = 29.6 bits (65), Expect = 7.0 Identities = 18/50 (36%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = -3 Query: 563 C*SALGFNHPQKGTTLR*DSCKLGETA-*TKQQDLCCRCQPVFLAVNLQF 417 C ALGF P G T+ D C+ G T T C CQP + Q+ Sbjct: 4273 CSCALGFTGPNCGKTVCEDFCQNGGTCIVTAGNQPYCHCQPEYTGDRCQY 4322 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,746,174 Number of Sequences: 219361 Number of extensions: 1197160 Number of successful extensions: 2661 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2506 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2657 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5310515667 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)