| Clone Name | baal33d15 |
|---|---|
| Clone Library Name | barley_pub |
>YWZ5_CAEEL (Q11095) Hypothetical protein C02B8.5| Length = 453 Score = 34.3 bits (77), Expect = 0.083 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 198 NTIWCSRCEIWWKWRDVPVDKY 133 N+ WC C + W+WR +P D Y Sbjct: 412 NSEWCGLCNLCWQWRKLPADYY 433
>PFA5_YEAST (Q03289) Palmitoyltransferase PFA5 (EC 2.3.1.-) (Protein fatty| acyltransferase 5) Length = 374 Score = 29.6 bits (65), Expect = 2.0 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -1 Query: 252 YDKYRIDECIRADPIGHGNTIWCSRCE 172 YD +C ++DP HG IWCS C+ Sbjct: 111 YDAVVPPKCYQSDP--HGYPIWCSECQ 135
>MTCY_LEUME (P38577) Bacteriocin mesentericin Y105 precursor| Length = 61 Score = 29.6 bits (65), Expect = 2.0 Identities = 22/59 (37%), Positives = 30/59 (50%) Frame = -2 Query: 251 MINTESMSVYVRTQ*DMEIQYGVVGAKYGGNGETCRSTSTQKFIYYGSPSPAGHTRLAS 75 M N +S+ Y Q D + VVG KY GNG C T + + +G + AG RLA+ Sbjct: 1 MTNMKSVEAY--QQLDNQNLKKVVGGKYYGNGVHC--TKSGCSVNWGEAASAGIHRLAN 55
>FPG_BDEBA (Q6ML45) Formamidopyrimidine-DNA glycosylase (EC 3.2.2.23)| (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (EC 4.2.99.18) (AP lyase mutM) Length = 269 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = -1 Query: 291 FYQYPNRLYSMTMYDKYRIDECIRADPIGHGNTIWCSRCE 172 ++Q R+Y + +++ +G NT WCSRC+ Sbjct: 229 YFQTSFRVYGRDKEPCVTCGQQVKSKVLGGRNTFWCSRCQ 268
>FER_THEAC (P00218) Zinc-containing ferredoxin| Length = 142 Score = 28.1 bits (61), Expect = 5.9 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -1 Query: 252 YDKYRIDECIRADPIGHGNTIWCSRCE 172 ++KYR D+C DP+ + I+C CE Sbjct: 107 WNKYRTDKC---DPVRESDCIFCMACE 130
>SYT_MANSM (Q65TQ0) Threonyl-tRNA synthetase (EC 6.1.1.3) (Threonine--tRNA| ligase) (ThrRS) Length = 643 Score = 27.7 bits (60), Expect = 7.8 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 7/53 (13%) Frame = +3 Query: 120 DKFLRTCRPARLAI--STIFRTDYTILYFH-----VLLGPHVYTHRFCIYHTL 257 D F + P ++AI I + D+ LY H + GPHV RFC + L Sbjct: 146 DTFEKRGEPYKMAILDENIAKDDHPALYHHEEYIDMCRGPHVPNMRFCHHFKL 198
>RHOC_MOUSE (Q62159) Rho-related GTP-binding protein RhoC precursor| (Silica-induced gene 61 protein) (SIG-61) Length = 193 Score = 27.7 bits (60), Expect = 7.8 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -3 Query: 178 VRNMVEMARRAGRQVRKN 125 VR + EMA RAG QVRKN Sbjct: 167 VREVFEMATRAGLQVRKN 184
>RHOC_HUMAN (P08134) Rho-related GTP-binding protein RhoC precursor (H9)| Length = 193 Score = 27.7 bits (60), Expect = 7.8 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -3 Query: 178 VRNMVEMARRAGRQVRKN 125 VR + EMA RAG QVRKN Sbjct: 167 VREVFEMATRAGLQVRKN 184 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,375,644 Number of Sequences: 219361 Number of extensions: 726315 Number of successful extensions: 1840 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1824 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1840 length of database: 80,573,946 effective HSP length: 74 effective length of database: 64,341,232 effective search space used: 1544189568 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)