>BKLH5_HUMAN (Q96NJ5) BTB and kelch domain-containing protein 5|
          Length = 620

 Score = 30.0 bits (66), Expect = 6.3
 Identities = 16/51 (31%), Positives = 25/51 (49%)
 Frame = +3

Query: 441 DEKGDRLDVSEDTAHQISVDPWYQVGFVLTTGVNSAYVLGYSGSIMVPLGW 593
           D   DR+ V    ++ I  D W +  F L TG N + V  ++G I +  G+
Sbjct: 505 DYNNDRILVRHIDSYNIDTDQWTRCNFNLLTGQNESGVAVHNGRIYLVGGY 555


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 76,634,640
Number of Sequences: 219361
Number of extensions: 1343286
Number of successful extensions: 3485
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3390
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3485
length of database: 80,573,946
effective HSP length: 108
effective length of database: 56,882,958
effective search space used: 6257125380
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)