| Clone Name | baal32m05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | BKLH5_HUMAN (Q96NJ5) BTB and kelch domain-containing protein 5 | 30 | 6.3 |
|---|
>BKLH5_HUMAN (Q96NJ5) BTB and kelch domain-containing protein 5| Length = 620 Score = 30.0 bits (66), Expect = 6.3 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = +3 Query: 441 DEKGDRLDVSEDTAHQISVDPWYQVGFVLTTGVNSAYVLGYSGSIMVPLGW 593 D DR+ V ++ I D W + F L TG N + V ++G I + G+ Sbjct: 505 DYNNDRILVRHIDSYNIDTDQWTRCNFNLLTGQNESGVAVHNGRIYLVGGY 555 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,634,640 Number of Sequences: 219361 Number of extensions: 1343286 Number of successful extensions: 3485 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3485 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6257125380 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)