| Clone Name | baal32m01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KAPP_ARATH (P46014) Kinase-associated protein phosphatase (EC 3.... | 67 | 4e-11 | 2 | CADB_ECOLI (P0AAE8) Probable cadaverine/lysine antiporter | 31 | 4.1 | 3 | CADB_ECOL6 (P0AAE9) Probable cadaverine/lysine antiporter | 31 | 4.1 | 4 | CADB_ECO57 (P0AAF0) Probable cadaverine/lysine antiporter | 31 | 4.1 | 5 | RL2_TOBAC (P25998) 60S ribosomal protein L2 | 30 | 9.0 |
|---|
>KAPP_ARATH (P46014) Kinase-associated protein phosphatase (EC 3.1.3.16)| Length = 581 Score = 67.4 bits (163), Expect = 4e-11 Identities = 33/56 (58%), Positives = 41/56 (73%) Frame = +1 Query: 226 SHLTLEVIAGPSHGINRYLQSGNTSMLPMTLGRIPQSDLVFKDSEVSGKHARIDWN 393 S L LEVIAGP+ G+ + S ++S LP+ LGR+ SDL KDSEVSGKHA+I WN Sbjct: 180 SWLFLEVIAGPAIGLQHAVNSTSSSKLPVKLGRVSPSDLALKDSEVSGKHAQITWN 235
>CADB_ECOLI (P0AAE8) Probable cadaverine/lysine antiporter| Length = 444 Score = 30.8 bits (68), Expect = 4.1 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +2 Query: 2 LGSTLKRTAEASVRASEAKHTRRTSGENNNGGIPVKDITVGKTSFH*LDVLVVLM 166 LGS + +A VRA+ + + GE ++ GIP K + + L +L+ LM Sbjct: 286 LGSWMMLVGQAGVRAANDGNFPKVYGEVDSNGIPKKGLLLAAVKMTALMILITLM 340
>CADB_ECOL6 (P0AAE9) Probable cadaverine/lysine antiporter| Length = 444 Score = 30.8 bits (68), Expect = 4.1 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +2 Query: 2 LGSTLKRTAEASVRASEAKHTRRTSGENNNGGIPVKDITVGKTSFH*LDVLVVLM 166 LGS + +A VRA+ + + GE ++ GIP K + + L +L+ LM Sbjct: 286 LGSWMMLVGQAGVRAANDGNFPKVYGEVDSNGIPKKGLLLAAVKMTALMILITLM 340
>CADB_ECO57 (P0AAF0) Probable cadaverine/lysine antiporter| Length = 444 Score = 30.8 bits (68), Expect = 4.1 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +2 Query: 2 LGSTLKRTAEASVRASEAKHTRRTSGENNNGGIPVKDITVGKTSFH*LDVLVVLM 166 LGS + +A VRA+ + + GE ++ GIP K + + L +L+ LM Sbjct: 286 LGSWMMLVGQAGVRAANDGNFPKVYGEVDSNGIPKKGLLLAAVKMTALMILITLM 340
>RL2_TOBAC (P25998) 60S ribosomal protein L2| Length = 260 Score = 29.6 bits (65), Expect = 9.0 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 1/62 (1%) Frame = +1 Query: 127 NVLSLAGCPSGPYVANIIHAYAHDI*SFARSAGSHLTLEVIAGPSHGINRY-LQSGNTSM 303 NVL L P G V N+ H D FAR +G++ + + P +G R L SG+ + Sbjct: 100 NVLPLRSIPEGAVVCNVEHKVG-DRGVFARCSGAY-AIVISHNPDNGTTRIKLPSGSKKI 157 Query: 304 LP 309 +P Sbjct: 158 VP 159 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 94,473,950 Number of Sequences: 219361 Number of extensions: 1879055 Number of successful extensions: 4090 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3857 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4056 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6825954960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)