| Clone Name | baal33a23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | 5HT1R_DROME (P20905) 5-hydroxytryptamine receptor 1 (5-HT recept... | 29 | 3.0 | 2 | R1B12_SOLDE (Q6L3Z4) Putative late blight resistance protein hom... | 28 | 6.8 |
|---|
>5HT1R_DROME (P20905) 5-hydroxytryptamine receptor 1 (5-HT receptor) (Serotonin| receptor 1) (5HT-dro) Length = 564 Score = 28.9 bits (63), Expect = 3.0 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 1/57 (1%) Frame = +1 Query: 28 MDL*TQTGRRHSSLKGHRHHHQWEGSTARFTTAKKMKFV-FTNLWLLMSNSKREYPA 195 M L Q RRH S + HR+H +TA FV F + W+ + K PA Sbjct: 1 MALSGQDWRRHQSHRQHRNHRTQGNHQKLISTATLTLFVLFLSSWIAYAAGKATVPA 57
>R1B12_SOLDE (Q6L3Z4) Putative late blight resistance protein homolog R1B-12| Length = 1296 Score = 27.7 bits (60), Expect = 6.8 Identities = 15/54 (27%), Positives = 31/54 (57%) Frame = +1 Query: 85 HHQWEGSTARFTTAKKMKFVFTNLWLLMSNSKREYPALHQLL*PILWCQEIIQV 246 H +WE S A+F K +K + +L L+ + +P L QL+ + C++++++ Sbjct: 1135 HSEWEVSNAKFPQLKILKLEYVSLMKLIV-ADDAFPNLEQLV--LHDCEDLMEI 1185 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,029,431 Number of Sequences: 219361 Number of extensions: 933551 Number of successful extensions: 2019 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1972 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2017 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)