| Clone Name | baal32h06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TAT_HV1SC (P05906) TAT protein (Transactivating regulatory protein) | 28 | 7.5 | 2 | CTL4_MOUSE (Q91VA1) Choline transporter-like protein 4 (Solute c... | 28 | 7.5 | 3 | Y4MM_RHISN (P55572) Hypothetical protein y4mM precursor | 28 | 7.5 | 4 | TORC_ECOLI (P33226) Cytochrome c-type protein torC | 27 | 9.8 | 5 | TORC_ECO57 (P58359) Cytochrome c-type protein torC | 27 | 9.8 |
|---|
>TAT_HV1SC (P05906) TAT protein (Transactivating regulatory protein)| Length = 101 Score = 27.7 bits (60), Expect = 7.5 Identities = 18/50 (36%), Positives = 24/50 (48%) Frame = -2 Query: 227 DVRLNWLPHAGWKKTAWTSGCFQCHACSAIGQGRTRTTGLGIFHGGQRRR 78 D RL H G + A + C+ C C Q T GLGI +G ++RR Sbjct: 5 DPRLEPWKHPGSQPKAACTSCY-CKKCCFHCQVCFTTKGLGISYGRKKRR 53
>CTL4_MOUSE (Q91VA1) Choline transporter-like protein 4 (Solute carrier family| 44 member 4) Length = 707 Score = 27.7 bits (60), Expect = 7.5 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = -3 Query: 325 FFFFSGRFLKQGAGYDSNVFFLNYPWFTFTNLVMYA 218 FFFFSGR +G G D LNY W +M A Sbjct: 612 FFFFSGRI--KGLGKDFENPNLNYYWLPIMTSIMGA 645
>Y4MM_RHISN (P55572) Hypothetical protein y4mM precursor| Length = 541 Score = 27.7 bits (60), Expect = 7.5 Identities = 26/86 (30%), Positives = 40/86 (46%), Gaps = 7/86 (8%) Frame = -3 Query: 313 SGRFLKQGAGYD--SNVFFLNYPWFTFTNLVMYA*IGCHMQA----GRKRHG-RQAAFNA 155 + R++ G G+ + L +PWF +V+ A G HM + R G R AF A Sbjct: 404 AARYVLAGGGFSFAQELPVLIFPWFILGGIVLAAHSGGHMAVEWIYDKLRDGARSTAFVA 463 Query: 154 MHAVL*AKGAQGQLDLEFSMVGKDAG 77 + V + GA L + +VG+ AG Sbjct: 464 ANLV--SAGAFLMLGYQAYLVGEIAG 487
>TORC_ECOLI (P33226) Cytochrome c-type protein torC| Length = 390 Score = 27.3 bits (59), Expect = 9.8 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -2 Query: 257 LSLVHLH*SRDVRLNWLPHAGWKKTAWTSGCFQCHACSAI 138 L+LV + + L LPH G K T+ T C CH+ + Sbjct: 18 LALVAIGIVIGIALIVLPHVGIKVTSTTEFCVSCHSMQPV 57
>TORC_ECO57 (P58359) Cytochrome c-type protein torC| Length = 390 Score = 27.3 bits (59), Expect = 9.8 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -2 Query: 257 LSLVHLH*SRDVRLNWLPHAGWKKTAWTSGCFQCHACSAI 138 L+LV + + L LPH G K T+ T C CH+ + Sbjct: 18 LALVAIGIVIGIALIVLPHVGIKVTSTTEFCVSCHSMQPV 57 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,398,646 Number of Sequences: 219361 Number of extensions: 822093 Number of successful extensions: 1999 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1931 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1999 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)