| Clone Name | baal32b22 |
|---|---|
| Clone Library Name | barley_pub |
>CTGE5_MOUSE (Q8R311) Cutaneous T-cell lymphoma-associated antigen 5 homolog| (cTAGE-5 protein) (Meningioma-expressed antigen 6) Length = 779 Score = 34.3 bits (77), Expect = 0.23 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = +2 Query: 11 GPPXPPIPSRTLLQPHHRTSAPFLPPRS 94 GPP PP P RT+ P R P+LPPR+ Sbjct: 718 GPPLPPFPGRTVYAP--RGFPPYLPPRA 743
>AMBN_RAT (Q62840) Ameloblastin precursor (Amelin)| Length = 422 Score = 32.7 bits (73), Expect = 0.67 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 23 PPIPSRTLLQPHHRTSAPFLPPRSPVGYRI 112 PP+PS+ LQPH PFL P + G ++ Sbjct: 113 PPLPSQPSLQPHQPGLKPFLQPTAATGVQV 142
>UBP2L_HUMAN (Q14157) Ubiquitin-associated protein 2-like| Length = 983 Score = 32.0 bits (71), Expect = 1.1 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 7/40 (17%) Frame = +2 Query: 8 RGPPXPPIPSRTLLQP-------HHRTSAPFLPPRSPVGY 106 RG P P+ TL QP HH T FL P P GY Sbjct: 867 RGDASSPAPATTLAQPQQNQTQTHHTTQQTFLNPALPPGY 906
>ADO1_ARATH (Q94BT6) Adagio protein 1 (Protein ZEITLUPE) (LOV kelch protein 1)| (Flavin-binding kelch repeat F-box protein 1-like protein 2) (FKF1-like protein 2) (F-box only protein 2b) (FBX2b) (Clock-associated PAS protein ZTL) Length = 609 Score = 32.0 bits (71), Expect = 1.1 Identities = 22/77 (28%), Positives = 36/77 (46%) Frame = -2 Query: 332 LAIRRRLWVGLGAMSAESSRIGAPCGVMGPRTVLHNGEIYRTLPETAVTGDPTRSCVKRE 153 L+I + +W + A SR+G V G R +L G + ++ P + D + E Sbjct: 431 LSIEKPVWREIPAAWTPPSRLGHTLSVYGGRKILMFGGLAKSGPLKFRSSDVFTMDLSEE 490 Query: 152 KWDVRGMDASGMDGSGN 102 + R + SGM G+GN Sbjct: 491 EPCWRCVTGSGMPGAGN 507
>EP400_MOUSE (Q8CHI8) E1A-binding protein p400 (EC 3.6.1.-) (p400 kDa| SWI2/SNF2-related protein) (Domino homolog) (mDomino) Length = 3072 Score = 30.8 bits (68), Expect = 2.5 Identities = 24/76 (31%), Positives = 33/76 (43%), Gaps = 5/76 (6%) Frame = +1 Query: 94 PRRLPDPSIPDASIPLTSHFSLLTQLLVGS-----PVTAVSGNVR*ISPL*STVRGPMTP 258 P RLP S+P ++P T FS +Q++ S PV N +PL S + P + Sbjct: 592 PARLPPASVPATALPSTLQFSQQSQMVEASTQLQIPVKTQQLNAPIPAPLPSQLPAPSSQ 651 Query: 259 QGAPIRLDSALMAPNP 306 P AL P P Sbjct: 652 PAQP-----ALHVPMP 662
>VE2_HPV16 (P03120) Regulatory protein E2| Length = 365 Score = 30.0 bits (66), Expect = 4.3 Identities = 14/27 (51%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = -1 Query: 387 TDERRTTWQ-PAAEPDTRNPSHQAKVV 310 T+E +TT Q P +EPDT NP H K++ Sbjct: 231 TEETQTTIQRPRSEPDTGNPCHTTKLL 257
>MOAA_AERPE (Q9YEV3) Probable molybdenum cofactor biosynthesis protein A| Length = 355 Score = 28.9 bits (63), Expect = 9.6 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = +3 Query: 105 TGSVHPRRIH--PSHIPFLSLDAASRRVTCDGCFRQR 209 TG +H RR++ PS + +D V C GC+R R Sbjct: 223 TGRLHNRRVYRLPSGVRVYLVDPVENPVFCMGCYRVR 259 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,668,310 Number of Sequences: 219361 Number of extensions: 1639697 Number of successful extensions: 4815 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4500 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4806 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4258037034 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)