| Clone Name | baal31i20 |
|---|---|
| Clone Library Name | barley_pub |
>MTF1_MOUSE (Q07243) Metal-regulatory transcription factor 1 (Transcription| factor MTF-1) (MRE-binding transcription factor) Length = 675 Score = 34.3 bits (77), Expect = 0.088 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +1 Query: 127 GLLQHVVDPSEIHPSIHPSIYPMDRIISGRLL 222 G +QH++ P +IH +I+P PM R I G L Sbjct: 91 GYVQHIISPDQIHLTINPGSTPMPRNIEGATL 122
>MTF1_HUMAN (Q14872) Metal-regulatory transcription factor 1 (Transcription| factor MTF-1) (MRE-binding transcription factor) Length = 753 Score = 34.3 bits (77), Expect = 0.088 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +1 Query: 127 GLLQHVVDPSEIHPSIHPSIYPMDRIISGRLL 222 G +QH++ P +IH +I+P PM R I G L Sbjct: 92 GYVQHIISPDQIHLTINPGSTPMPRNIEGATL 123
>YX0A_CAEEL (Q11116) Hypothetical protein C03B1.10| Length = 52 Score = 32.3 bits (72), Expect = 0.33 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = -1 Query: 189 VDGWMDGWMDFRWIYHMLEKSMGGSPR 109 +DGWMDGWMD W+ ++ MGG R Sbjct: 21 MDGWMDGWMD-GWMDGWMDGWMGGLGR 46 Score = 32.3 bits (72), Expect = 0.33 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -2 Query: 194 IG*MDGWMDGWISDGSTTCWRSPW 123 +G MDGWMDGW+ DG W W Sbjct: 18 LGWMDGWMDGWM-DGWMDGWMDGW 40
>AATB2_RHIME (Q06191) Aspartate aminotransferase B (EC 2.6.1.1) (Transaminase A)| (AspAT) Length = 410 Score = 29.6 bits (65), Expect = 2.2 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 3/45 (6%) Frame = +2 Query: 71 PSSRSYVDLEQLCRGEPPM---DFSNMW*IHLKSIHPSIHPSTRW 196 P SY D+ Q+C G+P + D S+ + + + + +I P TRW Sbjct: 133 PYWTSYSDIVQICEGKPILIACDASSGFRLTAQKLEAAITPRTRW 177
>UNC36_CAEEL (P34374) Voltage-dependent calcium channel unc-36 precursor| (Uncoordinated protein 36) Length = 1249 Score = 28.5 bits (62), Expect = 4.8 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 6/40 (15%) Frame = +1 Query: 127 GLLQHVVDPSEIHPSIHPSIYPMDRII------SGRLLWW 228 G + HV + +++ IH I M R++ SG+L WW Sbjct: 457 GYMVHVANMADVDEKIHHYIRRMSRVVGRHYKESGQLSWW 496
>SKIL_PONPY (Q5R431) Ski-like protein (Ski-related protein)| Length = 684 Score = 28.5 bits (62), Expect = 4.8 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = -3 Query: 238 SMATTKANGRR*SCPSGRWMDGWMDGFQMDLPHVGEVHGRLAPAQLL 98 SM + K N + PSG + W + + HV + H L P+ L Sbjct: 356 SMRSGKRNQSKTDAPSGMELQSWYPVIKQEGDHVSQTHSFLHPSYYL 402
>SKIL_HUMAN (P12757) Ski-like protein (Ski-related protein) (Ski-related| oncogene) Length = 684 Score = 28.5 bits (62), Expect = 4.8 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = -3 Query: 238 SMATTKANGRR*SCPSGRWMDGWMDGFQMDLPHVGEVHGRLAPAQLL 98 SM + K N + PSG + W + + HV + H L P+ L Sbjct: 356 SMRSGKRNQSKTDAPSGMELQSWYPVIKQEGDHVSQTHSFLHPSYYL 402
>FLI1_MOUSE (P26323) Friend leukemia integration 1 transcription factor| (Retroviral integration site protein Fli-1) Length = 452 Score = 27.7 bits (60), Expect = 8.2 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 2/28 (7%) Frame = +3 Query: 114 ASLPWTSPTCGRSI*NPSI--HPSIHLP 191 AS WTSPT G NPS+ HP+ H+P Sbjct: 419 ASQYWTSPTAG-IYPNPSVPRHPNTHVP 445 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,073,392 Number of Sequences: 219361 Number of extensions: 566109 Number of successful extensions: 1715 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1644 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1701 length of database: 80,573,946 effective HSP length: 57 effective length of database: 68,070,369 effective search space used: 1633688856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)