| Clone Name | baal30n18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | INSR_XENLA (Q9PVZ4) Insulin receptor precursor (EC 2.7.10.1) (IR... | 29 | 7.8 | 2 | OVO_DROME (P51521) Protein ovo (Protein shaven baby) | 29 | 7.8 |
|---|
>INSR_XENLA (Q9PVZ4) Insulin receptor precursor (EC 2.7.10.1) (IR) (Xe-InsR)| (XTK-1b) [Contains: Insulin receptor alpha subunit; Insulin receptor beta subunit] Length = 1362 Score = 28.9 bits (63), Expect = 7.8 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = -2 Query: 185 IVKVLTAPCIRVFVLFYLLVLC 120 IVK++T P I VF+L +LV C Sbjct: 949 IVKIITGPIIAVFLLLIVLVYC 970
>OVO_DROME (P51521) Protein ovo (Protein shaven baby)| Length = 1351 Score = 28.9 bits (63), Expect = 7.8 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +1 Query: 268 HHRLPCLFHHHQIARLRPR-RISFHHLHGQTSTHQSYPWTAPSLARLAVAS 417 HH FHH Q + +P+ S HH HG +++ S P +P+ A A A+ Sbjct: 964 HHH----FHHQQQQQPQPQSHHSHHHGHGHDNSNMSLP--SPTAAAAAAAA 1008 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,780,548 Number of Sequences: 219361 Number of extensions: 799194 Number of successful extensions: 1962 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1917 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1961 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)