| Clone Name | baal31c06 |
|---|---|
| Clone Library Name | barley_pub |
>KL61_DROME (P46863) Bipolar kinesin KRP-130 (Kinesin-like protein Klp61F)| Length = 1066 Score = 33.5 bits (75), Expect = 0.61 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +2 Query: 59 HGHRRHRQWNRLGALSIPSADVLPNLEEE 145 H + H++ +LGA+S+P A+ L NL+EE Sbjct: 683 HAKQMHKKLEQLGAMSLPDAEELQNLQEE 711
>ANKH_BRARE (P58368) Progressive ankylosis protein homolog (ANK)| Length = 501 Score = 32.3 bits (72), Expect = 1.4 Identities = 26/99 (26%), Positives = 48/99 (48%), Gaps = 12/99 (12%) Frame = +3 Query: 48 DAIRTVIGVIGNGTALVLFLSPVPT----FYRIWKKKTVEQY------SAVPYLAT--LL 191 D + V+ ++ GT ++F + + +Y I K V++ A YLA LL Sbjct: 82 DRTKAVLCMVVAGTVAIVFHTLIAYTNLGYYIINKLHHVDESVGSKTRKAFLYLAAFPLL 141 Query: 192 NCMMWVLYGLPLVHPHSMLVITINGTGMVIELAYIALFL 308 + M W G+ L H HS+LV + + +V ++ ++ + L Sbjct: 142 DAMAWTHAGILLKHKHSLLVGCASISDVVAQIVFVGILL 180
>PTAFR_BOVIN (Q9TTY5) Platelet-activating factor receptor (PAF-R) (PAFr)| Length = 342 Score = 30.4 bits (67), Expect = 5.2 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = -2 Query: 580 AVQQMPLTSEATDRNRGMYSTLLVWITIFMTESGAAYMPVPKRTQRMP 437 AV + T++AT R RG+ +L++W++I A+Y V T R P Sbjct: 118 AVTRPIKTAQATTRKRGILLSLIIWVSIV---GAASYFFVLDSTNREP 162
>TS1R1_HUMAN (Q7RTX1) Taste receptor type 1 member 1 precursor (G-protein| coupled receptor 70) (Gm148) Length = 841 Score = 29.6 bits (65), Expect = 8.8 Identities = 20/76 (26%), Positives = 32/76 (42%), Gaps = 9/76 (11%) Frame = +3 Query: 102 FLSPVPTFYRIW-KKKTVEQYSAVPYLATLLNCMMWVLYGLPLV------HPHSMLV--I 254 F + VPTFY W + + + A LL C+ W++ PL PH +++ Sbjct: 662 FSTKVPTFYHAWVQNHGAGLFVMISSAAQLLICLTWLVVWTPLPAREYQRFPHLVMLECT 721 Query: 255 TINGTGMVIELAYIAL 302 N G ++ Y L Sbjct: 722 ETNSLGFILAFLYNGL 737
>CHS2_EXODE (P30601) Chitin synthase 2 (EC 2.4.1.16) (Chitin-UDP| acetyl-glucosaminyl transferase 2) (Class-I chitin synthase 2) Length = 928 Score = 29.6 bits (65), Expect = 8.8 Identities = 14/46 (30%), Positives = 27/46 (58%) Frame = +3 Query: 174 YLATLLNCMMWVLYGLPLVHPHSMLVITINGTGMVIELAYIALFLT 311 YL TLL C + + P +P S +++ I + +++ L + ++FLT Sbjct: 654 YLGTLLYCFILSMGNRPQGNPKSYMMMVIFWSVLMVWLTFASIFLT 699 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,560,060 Number of Sequences: 219361 Number of extensions: 1188966 Number of successful extensions: 4029 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3913 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4029 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6655306086 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)