ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baal30l12 |
|---|---|
| Clone Library Name | barley_pub |
>TCL2_CAEEL (Q9N428) T-cell defective protein 2| Length = 435 Score = 30.8 bits (68), Expect = 0.83 Identities = 12/35 (34%), Positives = 23/35 (65%) Frame = +2 Query: 191 SLKRGRSKLIRIFRLCNYFPPRKEMMRFSSNWVLI 295 +LK + K +RI++L + P+KE+ +S W++I Sbjct: 341 ALKEAKEKEMRIWKLAPFETPKKEVPLYSGRWLVI 375
>Y157_AQUAE (O66547) Hypothetical protein aq_157 precursor| Length = 162 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/27 (48%), Positives = 21/27 (77%) Frame = +1 Query: 142 FEKVMEEKRKALDALKKSEERKVEIDK 222 ++K+++EK+K L+ALKKS E K +K Sbjct: 53 YQKLIQEKQKKLEALKKSLESKALSEK 79
>KCY_PYRHO (O58988) Cytidylate kinase (EC 2.7.4.14) (CK) (Cytidine| monophosphate kinase) (CMP kinase) Length = 192 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/41 (31%), Positives = 25/41 (60%) Frame = +1 Query: 142 FEKVMEEKRKALDALKKSEERKVEIDKDLQAMQLLSTKKGN 264 F ++ +EK +L+ +K E EID+++ Q+ + K+GN Sbjct: 40 FRQMAKEKGMSLEEFQKYAELHPEIDREVDRRQIEAAKEGN 80
>BASP_RAT (Q05175) Brain acid soluble protein 1 (BASP1 protein) (Neuronal| axonal membrane protein NAP-22) (22 kDa neuronal tissue-enriched acidic protein) Length = 219 Score = 29.3 bits (64), Expect = 2.4 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 6/37 (16%) Frame = +1 Query: 1 QDEKAPAPEKQGARE------DAPKADENKASKDGAA 93 Q E APAPE++ A +APKA E A GAA Sbjct: 97 QPEPAPAPEQEAAAPGPAAGGEAPKAGEASAESTGAA 133
>BASP_MOUSE (Q91XV3) Brain acid soluble protein 1 (BASP1 protein) (Neuronal| axonal membrane protein NAP-22) (22 kDa neuronal tissue-enriched acidic protein) Length = 225 Score = 29.3 bits (64), Expect = 2.4 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 6/37 (16%) Frame = +1 Query: 1 QDEKAPAPEKQGARE------DAPKADENKASKDGAA 93 Q E APAPE++ A +APKA E A GAA Sbjct: 98 QPEPAPAPEQEAAAPGPAAGGEAPKAGEASAESTGAA 134
>FLHC_XENNE (Q9X9F3) Flagellar transcriptional activator flhC| Length = 194 Score = 29.3 bits (64), Expect = 2.4 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +2 Query: 179 ML*RSLKRGRSKLIRIFRLCNYFPPRKEMMRFSSNWVL 292 ML + R +LIR+++ PP K M+ FS++W + Sbjct: 28 MLESETQLSRGRLIRLYKELRGSPPPKGMLPFSTDWFM 65
>FLHC_SALTY (O52222) Flagellar transcriptional activator flhC| Length = 192 Score = 29.3 bits (64), Expect = 2.4 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +2 Query: 179 ML*RSLKRGRSKLIRIFRLCNYFPPRKEMMRFSSNWVL 292 ML + R +LIR+++ PP K M+ FS++W + Sbjct: 28 MLESETQLSRGRLIRLYKELRGSPPPKGMLPFSTDWFM 65
>CALD1_CHICK (P12957) Caldesmon (CDM)| Length = 771 Score = 28.5 bits (62), Expect = 4.1 Identities = 23/76 (30%), Positives = 32/76 (42%), Gaps = 7/76 (9%) Frame = +1 Query: 1 QDEKAPAPEKQGAREDAPKADEN---KASKDGAAVVXXXXXXXXXXXXXXFE----KVME 159 ++EK A EKQ A E+ A+E KA ++ A E K E Sbjct: 266 EEEKKAAEEKQKAEEEKKAAEERERAKAEEEKRAAEERERAKAEEERKAAEERERAKAEE 325 Query: 160 EKRKALDALKKSEERK 207 E++ A + K EERK Sbjct: 326 ERKAAEERAKAEEERK 341
>LPP20_HELPY (P0A0V0) LPP20 lipoprotein precursor| Length = 175 Score = 28.5 bits (62), Expect = 4.1 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 7/52 (13%) Frame = +1 Query: 160 EKRKALDALKK-------SEERKVEIDKDLQAMQLLSTKKGNDEVFIKLGAD 294 EK + +DA K +E+ +DK+L A ++L+ G D VF+ +G D Sbjct: 108 EKTRTVDASGKRSISGTDTEKISQLVDKELIASKMLARYVGKDRVFVLVGLD 159
>LPP20_HELPJ (P0A0V1) LPP20 lipoprotein precursor| Length = 175 Score = 28.5 bits (62), Expect = 4.1 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 7/52 (13%) Frame = +1 Query: 160 EKRKALDALKK-------SEERKVEIDKDLQAMQLLSTKKGNDEVFIKLGAD 294 EK + +DA K +E+ +DK+L A ++L+ G D VF+ +G D Sbjct: 108 EKTRTVDASGKRSISGTDTEKISQLVDKELIASKMLARYVGKDRVFVLVGLD 159
>FLHC_YEREN (O86047) Flagellar transcriptional activator flhC| Length = 193 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +2 Query: 179 ML*RSLKRGRSKLIRIFRLCNYFPPRKEMMRFSSNWVL 292 ML + R +LI++++ PP K M+ FS++W + Sbjct: 28 MLESETQLSRGRLIKLYKELRGSPPPKGMLPFSTDWFM 65
>FLHC_PROMI (O34202) Flagellar transcriptional activator flhC| Length = 193 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +2 Query: 179 ML*RSLKRGRSKLIRIFRLCNYFPPRKEMMRFSSNWVL 292 ML + R +LI++++ PP K M+ FS++W + Sbjct: 28 MLESETQLSRGRLIKLYKELRGSPPPKGMLPFSTDWFM 65
>FLHC_ERWCA (Q9X601) Flagellar transcriptional activator flhC| Length = 193 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +2 Query: 179 ML*RSLKRGRSKLIRIFRLCNYFPPRKEMMRFSSNWVL 292 ML + R +LI++++ PP K M+ FS++W + Sbjct: 28 MLESETQLSRGRLIKLYKELRGSPPPKGMLPFSTDWFM 65
>MYH10_RAT (Q9JLT0) Myosin-10 (Myosin heavy chain, nonmuscle IIb) (Nonmuscle| myosin heavy chain IIb) (NMMHC II-b) (NMMHC-IIB) (Cellular myosin heavy chain, type B) (Nonmuscle myosin heavy chain-B) (NMMHC-B) Length = 1976 Score = 28.1 bits (61), Expect = 5.4 Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 1/48 (2%) Frame = +1 Query: 145 EKVMEEKRKALDALKKSEERKVEID-KDLQAMQLLSTKKGNDEVFIKL 285 E +E++RK AL + ++K+EID KDL+A Q+ + K DEV +L Sbjct: 1602 EAELEDERKQR-ALAVASKKKMEIDLKDLEA-QIEAANKARDEVIKQL 1647
>MYH10_MOUSE (Q61879) Myosin-10 (Myosin heavy chain, nonmuscle IIb) (Nonmuscle| myosin heavy chain IIb) (NMMHC II-b) (NMMHC-IIB) (Cellular myosin heavy chain, type B) (Nonmuscle myosin heavy chain-B) (NMMHC-B) Length = 1976 Score = 28.1 bits (61), Expect = 5.4 Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 1/48 (2%) Frame = +1 Query: 145 EKVMEEKRKALDALKKSEERKVEID-KDLQAMQLLSTKKGNDEVFIKL 285 E +E++RK AL + ++K+EID KDL+A Q+ + K DEV +L Sbjct: 1602 EAELEDERKQR-ALAVASKKKMEIDLKDLEA-QIEAANKARDEVIKQL 1647
>MYH10_HUMAN (P35580) Myosin-10 (Myosin heavy chain, nonmuscle IIb) (Nonmuscle| myosin heavy chain IIb) (NMMHC II-b) (NMMHC-IIB) (Cellular myosin heavy chain, type B) (Nonmuscle myosin heavy chain-B) (NMMHC-B) Length = 1976 Score = 28.1 bits (61), Expect = 5.4 Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 1/48 (2%) Frame = +1 Query: 145 EKVMEEKRKALDALKKSEERKVEID-KDLQAMQLLSTKKGNDEVFIKL 285 E +E++RK AL + ++K+EID KDL+A Q+ + K DEV +L Sbjct: 1602 EAELEDERKQR-ALAVASKKKMEIDLKDLEA-QIEAANKARDEVIKQL 1647
>MYH10_BOVIN (Q27991) Myosin-10 (Myosin heavy chain, nonmuscle IIb) (Nonmuscle| myosin heavy chain IIb) (NMMHC II-b) (NMMHC-IIB) (Cellular myosin heavy chain, type B) (Nonmuscle myosin heavy chain-B) (NMMHC-B) Length = 1976 Score = 28.1 bits (61), Expect = 5.4 Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 1/48 (2%) Frame = +1 Query: 145 EKVMEEKRKALDALKKSEERKVEID-KDLQAMQLLSTKKGNDEVFIKL 285 E +E++RK AL + ++K+EID KDL+A Q+ + K DEV +L Sbjct: 1602 EAELEDERKQR-ALAVASKKKMEIDLKDLEA-QIEAANKARDEVIKQL 1647
>FLHC_SHIFL (P0ABZ0) Flagellar transcriptional activator flhC| Length = 192 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +2 Query: 179 ML*RSLKRGRSKLIRIFRLCNYFPPRKEMMRFSSNWVL 292 ML + R +LI++++ PP K M+ FS++W + Sbjct: 28 MLESETQLSRGRLIKLYKELRGSPPPKGMLPFSTDWFM 65
>FLHC_SERMA (O85807) Flagellar transcriptional activator flhC| Length = 194 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +2 Query: 179 ML*RSLKRGRSKLIRIFRLCNYFPPRKEMMRFSSNWVL 292 ML + R +LI++++ PP K M+ FS++W + Sbjct: 29 MLESETQLSRGRLIKLYKELRGSPPPKGMLPFSTDWFM 66
>FLHC_ECOLI (P0ABY7) Flagellar transcriptional activator flhC| Length = 192 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +2 Query: 179 ML*RSLKRGRSKLIRIFRLCNYFPPRKEMMRFSSNWVL 292 ML + R +LI++++ PP K M+ FS++W + Sbjct: 28 MLESETQLSRGRLIKLYKELRGSPPPKGMLPFSTDWFM 65
>FLHC_ECOL6 (P0ABY8) Flagellar transcriptional activator flhC| Length = 192 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +2 Query: 179 ML*RSLKRGRSKLIRIFRLCNYFPPRKEMMRFSSNWVL 292 ML + R +LI++++ PP K M+ FS++W + Sbjct: 28 MLESETQLSRGRLIKLYKELRGSPPPKGMLPFSTDWFM 65
>FLHC_ECO57 (P0ABY9) Flagellar transcriptional activator flhC| Length = 192 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +2 Query: 179 ML*RSLKRGRSKLIRIFRLCNYFPPRKEMMRFSSNWVL 292 ML + R +LI++++ PP K M+ FS++W + Sbjct: 28 MLESETQLSRGRLIKLYKELRGSPPPKGMLPFSTDWFM 65
>IF2P_YEAST (P39730) Eukaryotic translation initiation factor 5B (eIF-5B)| (Translation initiation factor IF-2) Length = 1002 Score = 27.7 bits (60), Expect = 7.0 Identities = 23/83 (27%), Positives = 36/83 (43%), Gaps = 2/83 (2%) Frame = +1 Query: 16 PAPEKQGAREDAPKADENKASKDGAAVVXXXXXXXXXXXXXXFE-KVMEEKRKALDALK- 189 P PE +D + E AS +GA + E KV+EEK+ LK Sbjct: 33 PNPESSAGADDTSR--EASASAEGAEAIEGDFMSTLKQSKKKQEKKVIEEKKDGKPILKS 90 Query: 190 KSEERKVEIDKDLQAMQLLSTKK 258 K E+ K + +K+ Q + + +K Sbjct: 91 KKEKEKEKKEKEKQKKKEQAARK 113
>Y049_MYCPN (P75065) Hypothetical protein MPN049 (D09_orf632)| Length = 632 Score = 27.7 bits (60), Expect = 7.0 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +1 Query: 148 KVMEEKRKALDALKKSEERKVEIDKDL 228 K +EE+RK L+ LKK ++ K E+ + L Sbjct: 342 KELEEQRKELERLKKEQQNKQELVESL 368
>Y1186_AQUAE (O67246) Hypothetical protein aq_1186| Length = 406 Score = 27.7 bits (60), Expect = 7.0 Identities = 18/48 (37%), Positives = 30/48 (62%), Gaps = 3/48 (6%) Frame = +1 Query: 142 FEKVMEEKRKALDALKK---SEERKVEIDKDLQAMQLLSTKKGNDEVF 276 F K ++ +KAL+A ++ +E K +IDK L+ L ST++GN + F Sbjct: 152 FTKNLQNLKKALEAFEEIQFNEGNKEKIDKPLK---LFSTEEGNVKEF 196
>TSC2_HUMAN (P49815) Tuberin (Tuberous sclerosis 2 protein)| Length = 1807 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 61 LPLVHPPVRPASQAQGPSHP 2 LPLVHPP + AQ P+ P Sbjct: 1765 LPLVHPPSHSKAPAQTPAEP 1784 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.304 0.125 0.318 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,184,266 Number of Sequences: 219361 Number of extensions: 445004 Number of successful extensions: 991 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 966 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 990 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 1391514312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (21.9 bits)
