| Clone Name | baal30k15 |
|---|---|
| Clone Library Name | barley_pub |
>CUCM1_CUCME (Q39547) Cucumisin precursor (EC 3.4.21.25) (Allergen Cuc m 1)| Length = 731 Score = 48.1 bits (113), Expect = 2e-05 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 1/78 (1%) Frame = +2 Query: 110 VHIVYVDRP-EDADPEEFHIRTLSPVLGSKEKARDAVLYHYKHAASGFSAKLTAEQVEDL 286 ++IVY+ R ED D H R + + A ++VL+ YK + +GF+ KLT E+ E + Sbjct: 33 IYIVYMGRKLEDPDSAHLHHRAMLEQVVGSTFAPESVLHTYKRSFNGFAVKLTEEEAEKI 92 Query: 287 KKQPGVLQVVPSQTLQLH 340 GV+ V ++ +LH Sbjct: 93 ASMEGVVSVFLNEMNELH 110
>SUBL_ARATH (O65351) Subtilisin-like protease precursor (EC 3.4.21.-)| (Cucumisin-like serine protease) Length = 757 Score = 45.8 bits (107), Expect = 8e-05 Identities = 23/54 (42%), Positives = 32/54 (59%) Frame = +2 Query: 215 VLYHYKHAASGFSAKLTAEQVEDLKKQPGVLQVVPSQTLQLHGQEGGHASTTRT 376 +LY Y++A GFS +LT E+ + L QPGV+ V+P +LH TTRT Sbjct: 65 LLYTYENAIHGFSTRLTQEEADSLMTQPGVISVLPEHRYELH--------TTRT 110
>XSP1_ARATH (Q9LLL8) Xylem serine proteinase 1 precursor (EC 3.4.21.-) (AtXSP1)| (Cucumisin-like protein) Length = 749 Score = 42.0 bits (97), Expect = 0.001 Identities = 24/78 (30%), Positives = 47/78 (60%), Gaps = 2/78 (2%) Frame = +2 Query: 113 HIVYV-DRPEDADPE-EFHIRTLSPVLGSKEKARDAVLYHYKHAASGFSAKLTAEQVEDL 286 +I+Y+ DRP++ + + HI LS + S+E+A++ +Y Y A + F+AKL+ + + + Sbjct: 38 YIIYLGDRPDNTEETIKTHINLLSSLNISQEEAKERKVYSYTKAFNAFAAKLSPHEAKKM 97 Query: 287 KKQPGVLQVVPSQTLQLH 340 + V+ V +Q +LH Sbjct: 98 MEMEEVVSVSRNQYRKLH 115
>DAG_ANTMA (Q38732) DAG protein, chloroplast precursor| Length = 230 Score = 41.2 bits (95), Expect = 0.002 Identities = 24/85 (28%), Positives = 43/85 (50%), Gaps = 5/85 (5%) Frame = +2 Query: 116 IVYVDRPEDADPE-----EFHIRTLSPVLGSKEKARDAVLYHYKHAASGFSAKLTAEQVE 280 ++ ++ P+D P + ++ TL+ VLGS E+A+ + +GF +T E E Sbjct: 90 LIVMEFPKDPAPTREQMIDTYLNTLATVLGSMEEAKKNMYAFSTTTYTGFQCTVTEETSE 149 Query: 281 DLKKQPGVLQVVPSQTLQLHGQEGG 355 K PGVL V+P + + ++ G Sbjct: 150 KFKGLPGVLWVLPDSYIDVKNKDYG 174
>CUDP_METAN (P29138) Cuticle-degrading protease precursor (EC 3.4.21.-) (PR1)| (Chymoelastase) Length = 388 Score = 31.6 bits (70), Expect = 1.6 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = +2 Query: 227 YKHAASGFSAKLTAEQVEDLKKQPGVLQVVPSQTLQLHG 343 Y+HA GF+ LT E+++ L++ PGV + +++ G Sbjct: 70 YEHAFHGFAGSLTKEELKMLREHPGVDFIEKDAVMRISG 108
>ODO2_AZOVI (P20708) Dihydrolipoyllysine-residue succinyltransferase component| of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61) (E2) (Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex) Length = 398 Score = 31.6 bits (70), Expect = 1.6 Identities = 19/77 (24%), Positives = 33/77 (42%) Frame = +2 Query: 158 FHIRTLSPVLGSKEKARDAVLYHYKHAASGFSAKLTAEQVEDLKKQPGVLQVVPSQTLQL 337 F+ + PV+ + K +D + GF + VE LK+QPGV + + Sbjct: 197 FNEVNMKPVMELRAKYKDLFEKTHNGVRLGFMSFFVKAAVEALKRQPGVNASIDGNDIVY 256 Query: 338 HGQEGGHASTTRTMGLM 388 HG + + + GL+ Sbjct: 257 HGYQDIGVAVSSDRGLV 273
>PROA_VIBAL (P16588) Alkaline serine exoprotease A precursor (EC 3.4.21.-)| Length = 534 Score = 31.2 bits (69), Expect = 2.0 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = +2 Query: 227 YKHAASGFSAKLTAEQVEDLKKQPGVLQVVPSQTLQLHGQEGGHASTTRTM 379 + H+ SGF A L+ EQ++DL+ P V + + L L A+ T + Sbjct: 98 FDHSISGFVANLSPEQLKDLRSDPRVDYIEQDRILSLDPIVSADANQTNAI 148
>AEP3_CANGA (Q6FKT1) ATPase expression protein 3| Length = 623 Score = 31.2 bits (69), Expect = 2.0 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = -2 Query: 535 NLYALVRLHLHTSGTGS-CQSKLTVHPLFLHYSHEMRRPSDHHSHTIRLSHKAH 377 N L++ + H G GS Q K+ H L H++RR H+ + +LSH H Sbjct: 57 NFNQLIKDNAHLIGKGSQYQRKVVKHYLSPLIGHKLRRQDIHNDYNKQLSHTDH 110
>HRPX_PLALO (P04929) Histidine-rich glycoprotein precursor| Length = 351 Score = 29.3 bits (64), Expect = 7.8 Identities = 18/61 (29%), Positives = 20/61 (32%), Gaps = 20/61 (32%) Frame = -2 Query: 499 SGTGSCQSKL--------------------TVHPLFLHYSHEMRRPSDHHSHTIRLSHKA 380 SG+ SC S L TVHP LH H P +HH H Sbjct: 21 SGSNSCSSSLVKHIPQTGSNLTFDRVLVEDTVHPEHLHEEHHHHHPEEHHEPHHEEHHHH 80 Query: 379 H 377 H Sbjct: 81 H 81 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,464,575 Number of Sequences: 219361 Number of extensions: 1138021 Number of successful extensions: 3465 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 3370 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3463 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4488201198 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)