| Clone Name | baal30e24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TP53B_MOUSE (P70399) Tumor suppressor p53-binding protein 1 (p53... | 32 | 1.1 | 2 | Y159_METJA (Q57623) Hypothetical protein MJ0159 | 29 | 5.3 | 3 | RR7_CHLRE (P48267) Chloroplast 30S ribosomal protein S7 | 29 | 6.9 | 4 | ZYX_HUMAN (Q15942) Zyxin (Zyxin-2) | 28 | 9.1 | 5 | K0232_HUMAN (Q92628) Protein KIAA0232 (Fragment) | 28 | 9.1 |
|---|
>TP53B_MOUSE (P70399) Tumor suppressor p53-binding protein 1 (p53-binding protein| 1) (p53BP1) (53BP1) Length = 1957 Score = 31.6 bits (70), Expect = 1.1 Identities = 18/54 (33%), Positives = 24/54 (44%) Frame = +3 Query: 252 SPGDYHAVSPRFFGAPTQHHSTGSWPVRCSYGSSSDGDGAPPANFDASGEEFVD 413 S GD +S A + HH++ + + S S G GA P ASG E D Sbjct: 1280 SSGDLGDISSFSSKASSSHHTSSGTSLSAIHSSGSSGRGAGPLKGKASGTEAAD 1333
>Y159_METJA (Q57623) Hypothetical protein MJ0159| Length = 542 Score = 29.3 bits (64), Expect = 5.3 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = +3 Query: 345 GSSSDGDGAPPANFDASGEEFVD--SSVMEAVELRCV 449 G +G+G PANF G EF++ +++E EL+C+ Sbjct: 214 GIIENGEGYLPANFRYFGVEFLERFETILEIDELKCI 250
>RR7_CHLRE (P48267) Chloroplast 30S ribosomal protein S7| Length = 168 Score = 28.9 bits (63), Expect = 6.9 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 4/73 (5%) Frame = -2 Query: 295 APKNLGDTAW*SPGETAPEALLRMRTRLSSWPPIREPEVRAGAAQRG----RIGPRMTSI 128 A K +GD +P E +AL + R+ +P RAGA Q R+G R + Sbjct: 46 ALKEIGDVTQKNPVEVFEKALDNVTPRVEV-----KPRRRAGAIQMVPRVLRLGDRARAN 100 Query: 127 SLFWIIVVTEHRS 89 SL WI+ + RS Sbjct: 101 SLRWIMEACDKRS 113
>ZYX_HUMAN (Q15942) Zyxin (Zyxin-2)| Length = 572 Score = 28.5 bits (62), Expect = 9.1 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = -2 Query: 400 SPLASKFAGGAPSPSDDEP*LQRTGQEPVL*CWVGAPK 287 +P+ASKF+ GAP S +P Q+ G L G+P+ Sbjct: 274 TPVASKFSPGAPGGSGSQP-NQKLGHPEALSAGTGSPQ 310
>K0232_HUMAN (Q92628) Protein KIAA0232 (Fragment)| Length = 1402 Score = 28.5 bits (62), Expect = 9.1 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 336 CSYGSSSDGDGAPPANFDASGEEFVDS 416 CSY SSS APPA+ D S + +S Sbjct: 208 CSYSSSSSSSTAPPASTDTSSPKDCNS 234 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,111,552 Number of Sequences: 219361 Number of extensions: 1148774 Number of successful extensions: 3557 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3409 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3556 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)