| Clone Name | baal29p10 |
|---|---|
| Clone Library Name | barley_pub |
>PROC_RABIT (Q28661) Vitamin K-dependent protein C precursor (EC 3.4.21.69)| (Autoprothrombin IIA) (Anticoagulant protein C) (Blood coagulation factor XIV) [Contains: Vitamin K-dependent protein C light chain; Vitamin K-dependent protein C heavy chain; Act Length = 458 Score = 33.9 bits (76), Expect = 0.34 Identities = 23/53 (43%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = -3 Query: 449 GTTAHSLGRASCGCHRGSSGYSFCHRCVSIQ--SVCSGTCFQRC--AHSGTSC 303 GT A S+G SC CH G G SFC V SV +G C C +G SC Sbjct: 103 GTCADSIGGFSCQCHGGWEG-SFCQYEVRFSNCSVDNGGCAHYCLEEEAGRSC 154
>TRBM_BOVIN (P06579) Thrombomodulin (TM) (Fetomodulin) (CD141 antigen)| (Fragment) Length = 356 Score = 33.5 bits (75), Expect = 0.45 Identities = 20/59 (33%), Positives = 26/59 (44%), Gaps = 4/59 (6%) Frame = -3 Query: 437 HSLGRASCGCHRGSSGYSFCHRCVSIQSVCS--GTCFQRCAHS--GTSCHTCDWGLALL 273 H LG +C C G + HRC + C QRC ++ G CH CD G L+ Sbjct: 75 HGLGNYTCICEAGYQLAADQHRCEDVDDCAQLPSPCPQRCVNTEGGFQCH-CDTGYELV 132
>AL4A1_HUMAN (P30038) Delta-1-pyrroline-5-carboxylate dehydrogenase,| mitochondrial precursor (EC 1.5.1.12) (P5C dehydrogenase) (Aldehyde dehydrogenase 4A1) Length = 563 Score = 32.0 bits (71), Expect = 1.3 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = -3 Query: 437 HSLGRASCGCHRGSSGYSFCHRCVSIQSVCSGTCFQRCAHSGTSCHTC 294 H+ R + C G + F HR ++SV SGT + G C C Sbjct: 306 HTFPRLAGEC--GGKNFHFVHRSADVESVVSGTLRSAFEYGGQKCSAC 351
>COPB2_PSESM (P59572) Copper resistance protein B homolog precursor| Length = 294 Score = 31.6 bits (70), Expect = 1.7 Identities = 20/61 (32%), Positives = 30/61 (49%) Frame = -1 Query: 400 DPLVTVFVTDVCQSSQFAAVHVSKDVLILAPLVTLVTGDLPFCVKNSGQENHIAGLSNHR 221 D T F+ D Q++ A + D+L+ L+ TG+L F KN Q + +GLS Sbjct: 185 DVEATAFIGDAGQTA--ARLEADYDLLLTNDLILQPTGELNFYGKNDPQRGNGSGLSTSE 242 Query: 220 F 218 F Sbjct: 243 F 243
>WDR24_BRARE (Q7ZVL2) WD-repeat protein 24| Length = 779 Score = 31.2 bits (69), Expect = 2.2 Identities = 22/89 (24%), Positives = 36/89 (40%), Gaps = 8/89 (8%) Frame = -3 Query: 455 RAGTTAHSLGRASCGCHRGSSGY--SFCHRCVSIQSVCSGTC------FQRCAHSGTSCH 300 +A TT H + ++C + G+ CH+C S+ +VC Q C+H G H Sbjct: 699 QASTTLH-INCSNCKRPMSNKGWICDRCHQCASVCAVCHHVVKGLFVWCQGCSHGGHLEH 757 Query: 299 TCDWGLALLC*E*WTRKSHCWAQQSQICQ 213 +W + HC A +C+ Sbjct: 758 VMEW---------LKQSKHCPAGCGHLCE 777
>PENK_MESAU (P50175) Proenkephalin A precursor [Contains: Synenkephalin;| Met-enkephalin (Opioid growth factor) (OGF); Met-enkephalin-Arg-Gly-Leu; Leu-enkephalin; Met-enkephalin-Arg-Phe] Length = 268 Score = 31.2 bits (69), Expect = 2.2 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +2 Query: 227 IAEPSNVIFLSTILNTEGQVPSHKCDKRCQN 319 + P ++ FL+ L EGQ+PSHK + C++ Sbjct: 37 LVSPGDINFLACTLECEGQMPSHKIWETCKD 67
>EGFL9_HUMAN (Q6UY11) EGF-like domain-containing protein 9 precursor (Multiple| EGF-like domain protein 9) Length = 383 Score = 30.8 bits (68), Expect = 2.9 Identities = 19/46 (41%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Frame = -3 Query: 419 SCGCHRGSSGYSFCHRCVSIQSVCSGTCFQ--RC-AHSGTSCHTCD 291 SC C G G C RCV + GTC Q +C HSG + CD Sbjct: 45 SCRCDPGWEGLH-CERCVRMPGCQHGTCHQPWQCICHSGWAGKFCD 89
>EGFL9_MOUSE (Q8K1E3) EGF-like domain-containing protein 9 precursor (Multiple| EGF-like domain protein 9) (Endothelial cell-specific protein S-1) Length = 382 Score = 30.8 bits (68), Expect = 2.9 Identities = 19/46 (41%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Frame = -3 Query: 419 SCGCHRGSSGYSFCHRCVSIQSVCSGTCFQ--RC-AHSGTSCHTCD 291 SC C G G C RCV + GTC Q +C HSG + CD Sbjct: 45 SCRCDPGWEGLH-CERCVRMPGCQHGTCHQPWQCICHSGWAGKFCD 89
>WDR24_HUMAN (Q96S15) WD-repeat protein 24| Length = 920 Score = 30.8 bits (68), Expect = 2.9 Identities = 25/89 (28%), Positives = 34/89 (38%), Gaps = 8/89 (8%) Frame = -3 Query: 455 RAGTTAHSLGRASCGCHRGSSGY--SFCHRCVSIQSVCSGTC------FQRCAHSGTSCH 300 +A TT H + + C S G+ CHRC S+ +VC Q C+H G H Sbjct: 840 QASTTLH-VNCSHCKRPMSSRGWVCDRCHRCASMCAVCHHVVKGLFVWCQGCSHGGHLQH 898 Query: 299 TCDWGLALLC*E*WTRKSHCWAQQSQICQ 213 W SHC A +C+ Sbjct: 899 IMKW---------LEGSSHCPAGCGHLCE 918
>WDR24_MOUSE (Q8CFJ9) WD-repeat protein 24| Length = 790 Score = 30.8 bits (68), Expect = 2.9 Identities = 25/89 (28%), Positives = 34/89 (38%), Gaps = 8/89 (8%) Frame = -3 Query: 455 RAGTTAHSLGRASCGCHRGSSGY--SFCHRCVSIQSVCSGTC------FQRCAHSGTSCH 300 +A TT H + + C S G+ CHRC S+ +VC Q C+H G H Sbjct: 710 QASTTLH-VNCSHCKRPMSSRGWVCDRCHRCASMCAVCHHVVKGLFVWCQGCSHGGHLQH 768 Query: 299 TCDWGLALLC*E*WTRKSHCWAQQSQICQ 213 W SHC A +C+ Sbjct: 769 IMKW---------LEGSSHCPAGCGHLCE 788
>PBPA_XYLFA (Q9PGD4) Penicillin-binding protein 1A (PBP-1a) (PBP1a) [Includes:| Penicillin-insensitive transglycosylase (EC 2.4.2.-) (Peptidoglycan TGase); Penicillin-sensitive transpeptidase (EC 3.4.-.-) (DD-transpeptidase)] Length = 809 Score = 29.6 bits (65), Expect = 6.4 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +3 Query: 117 PPPPSAFTETPISETKKRGSVKRCLAAEQW 206 PP + +T TP+++ KRG V R E+W Sbjct: 380 PPAAARWTGTPLNKLLKRGDVVRVRPGEKW 409
>MTGA_NITEU (Q82U73) Monofunctional biosynthetic peptidoglycan transglycosylase| (EC 2.4.2.-) (Monofunctional TGase) Length = 244 Score = 29.6 bits (65), Expect = 6.4 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -1 Query: 508 VSFMLPPNPPHSLQLQWREREQLPTHSAERVVVVIED 398 + M NP SLQ QW + EQ+ +H +R V+ ED Sbjct: 61 LKIMRQQNPAASLQHQWVDYEQISSH-LKRAVIAAED 96
>L100_ADE05 (P24933) Late 100 kDa protein| Length = 807 Score = 29.3 bits (64), Expect = 8.4 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +3 Query: 87 PKAARVLTPSPPPPSAFTETPISETKKRGSVKRCLAA 197 P++ L P PPPP + + P + + G+ K AA Sbjct: 685 PQSGEELNPIPPPPQPYQQQPRALASQDGTQKEAAAA 721
>PCSK6_RAT (Q63415) Proprotein convertase subtilisin/kexin type 6 precursor| (EC 3.4.21.-) (Paired basic amino acid cleaving enzyme 4) (Subtilisin/kexin-like protease PACE4) (Subtilisin-like proprotein convertase 4) (SPC4) Length = 937 Score = 29.3 bits (64), Expect = 8.4 Identities = 20/62 (32%), Positives = 22/62 (35%), Gaps = 5/62 (8%) Frame = -3 Query: 434 SLGRASC--GCHRGS---SGYSFCHRCVSIQSVCSGTCFQRCAHSGTSCHTCDWGLALLC 270 SL R SC C G+ S C C C G + C H S H DW C Sbjct: 790 SLARGSCIPDCEPGTYFDSELIRCGECHHTCRTCVGPSREECIHCAKSFHFQDWKCVPAC 849 Query: 269 *E 264 E Sbjct: 850 GE 851 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,970,098 Number of Sequences: 219361 Number of extensions: 1697382 Number of successful extensions: 6284 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 5637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6251 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4872342800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)