| Clone Name | baal29l06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CBPD_RAT (Q9JHW1) Carboxypeptidase D precursor (EC 3.4.17.22) (M... | 29 | 3.6 | 2 | RERE_HUMAN (Q9P2R6) Arginine-glutamic acid dipeptide repeats pro... | 28 | 4.7 | 3 | MOSA_MAIZE (P15268) Autonomous transposable element EN-1 mosaic ... | 28 | 8.0 | 4 | YIPL_ORYSA (Q8S5M8) Protein yippee-like OJ1003C07.11 | 28 | 8.0 |
|---|
>CBPD_RAT (Q9JHW1) Carboxypeptidase D precursor (EC 3.4.17.22)| (Metallocarboxypeptidase D) (gp180) Length = 1378 Score = 28.9 bits (63), Expect = 3.6 Identities = 17/37 (45%), Positives = 19/37 (51%), Gaps = 5/37 (13%) Frame = -2 Query: 267 GRSLW-----QQVNPPPLPWQHPPAGVGLQAAAPLVP 172 GR LW + PPP P A VGL AA PL+P Sbjct: 96 GRPLWVLRLTAGLGPPPTP-----AAVGLDAAGPLLP 127
>RERE_HUMAN (Q9P2R6) Arginine-glutamic acid dipeptide repeats protein| (Atrophin-1-like protein) (Atrophin-1-related protein) Length = 1566 Score = 28.5 bits (62), Expect = 4.7 Identities = 20/52 (38%), Positives = 22/52 (42%) Frame = -2 Query: 258 LWQQVNPPPLPWQHPPAGVGLQAAAPLVPFXXXXXXXXXXXSVTPFVTCLSS 103 L Q N PP P HPP GL AP PF +TP TC S+ Sbjct: 1007 LTQSQNLPPPPASHPP--TGLHQVAPQPPFAQHPFVPGGPPPITP-PTCPST 1055
>MOSA_MAIZE (P15268) Autonomous transposable element EN-1 mosaic protein| (Suppressor-mutator system protein) (SPM) Length = 621 Score = 27.7 bits (60), Expect = 8.0 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 240 PPPLPWQHPPAGVGLQAAAPLVP 172 PPP+PW PP G Q+ +P +P Sbjct: 562 PPPMPWGFPPRG---QSQSPGLP 581
>YIPL_ORYSA (Q8S5M8) Protein yippee-like OJ1003C07.11| Length = 119 Score = 27.7 bits (60), Expect = 8.0 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -1 Query: 247 G*PSSIALAASTCRCRVASSSXVGSICFRGFFGA*FFLSYAI 122 G P+S L CR AS+ + S FRG FG + + + Sbjct: 16 GGPASAVLKCRRCRVDAASADAILSRDFRGRFGRAYLFDHVV 57 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,015,315 Number of Sequences: 219361 Number of extensions: 768209 Number of successful extensions: 2810 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2701 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2809 length of database: 80,573,946 effective HSP length: 64 effective length of database: 66,534,842 effective search space used: 1596836208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)