| Clone Name | baal28p24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LAMC1_HUMAN (P11047) Laminin gamma-1 chain precursor (Laminin B2... | 31 | 0.76 | 2 | LAMC1_MOUSE (P02468) Laminin gamma-1 chain precursor (Laminin B2... | 31 | 1.00 | 3 | LAMB1_HUMAN (P07942) Laminin beta-1 chain precursor (Laminin B1 ... | 30 | 2.2 | 4 | R1AB_CVHSA (P59641) Replicase polyprotein 1ab (pp1ab) (ORF1AB) [... | 28 | 8.4 |
|---|
>LAMC1_HUMAN (P11047) Laminin gamma-1 chain precursor (Laminin B2 chain)| Length = 1609 Score = 31.2 bits (69), Expect = 0.76 Identities = 16/57 (28%), Positives = 20/57 (35%), Gaps = 5/57 (8%) Frame = +3 Query: 9 EACRPLKCHAMLSLPTNCNSVASLYLYKSAVGS-----DRQNLYLSHWPICYPCSLC 164 E C+P CH SL C + VG+ + Y WP C C C Sbjct: 978 EGCKPCDCHPEGSLSLQCKDDGRCECREGFVGNRCDQCEENYFYNRSWPGCQECPAC 1034
>LAMC1_MOUSE (P02468) Laminin gamma-1 chain precursor (Laminin B2 chain)| Length = 1607 Score = 30.8 bits (68), Expect = 1.00 Identities = 16/57 (28%), Positives = 20/57 (35%), Gaps = 5/57 (8%) Frame = +3 Query: 9 EACRPLKCHAMLSLPTNCNSVASLYLYKSAVGS-----DRQNLYLSHWPICYPCSLC 164 E C+P CH SL C + VG+ + Y WP C C C Sbjct: 976 EGCKPCDCHHEGSLSLQCKDDGRCECREGFVGNRCDQCEENYFYNRSWPGCQECPAC 1032
>LAMB1_HUMAN (P07942) Laminin beta-1 chain precursor (Laminin B1 chain)| Length = 1786 Score = 29.6 bits (65), Expect = 2.2 Identities = 14/50 (28%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +3 Query: 15 CRPLKCHAMLSLPTNCNSV-ASLYLYKSAVGSDRQNLYLSHW--PICYPC 155 C+P +CH S+ CN V + ++ HW P C PC Sbjct: 818 CKPCECHLQGSVNAFCNPVTGQCHCFQGVYARQCDRCLPGHWGFPSCQPC 867
>R1AB_CVHSA (P59641) Replicase polyprotein 1ab (pp1ab) (ORF1AB) [Includes:| Replicase polyprotein 1a (pp1a) (ORF1A)] [Contains: Leader protein; p65 homolog; NSP1 (EC 3.4.22.-) (Papain-like proteinase) (PL-PRO); 3C-like proteinase (EC 3.4.22.-) (3CL-PRO) (3 Length = 7073 Score = 27.7 bits (60), Expect = 8.4 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 51 PTNCNSVASLYLYKSAVGSDRQNLYLSHWPICYPCSLCLS 170 P+ CN V LYL S V + + +PCS+CLS Sbjct: 2237 PSYCNGVRELYLNSSNVTT------MDFCEGSFPCSICLS 2270 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,655,680 Number of Sequences: 219361 Number of extensions: 481560 Number of successful extensions: 1125 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1124 length of database: 80,573,946 effective HSP length: 48 effective length of database: 70,044,618 effective search space used: 1681070832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)