| Clone Name | baal28l15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SUFS_WIGBR (Q8D2J7) Cysteine desulfurase (EC 2.8.1.7) (Selenocys... | 29 | 3.2 | 2 | HIS1_AQUAE (O67543) ATP phosphoribosyltransferase (EC 2.4.2.17) ... | 28 | 7.1 | 3 | ATPG_MYCPN (Q50330) ATP synthase gamma chain (EC 3.6.3.14) (ATP ... | 27 | 9.2 |
|---|
>SUFS_WIGBR (Q8D2J7) Cysteine desulfurase (EC 2.8.1.7) (Selenocysteine lyase)| (EC 4.4.1.16) (Selenocysteine reductase) (Selenocysteine beta-lyase) (SCL) Length = 410 Score = 28.9 bits (63), Expect = 3.2 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = -2 Query: 315 ICTYINSDLENEVYLVALTCANHTFPSTGTSETFLLEQDQMGIQIMEHH 169 I +IN+ ++E+ V T + ETF+ + D + I MEHH Sbjct: 76 IAKFINAKSDSEIIFVKGTTEGINLVANTWGETFIKKGDNIVITQMEHH 124
>HIS1_AQUAE (O67543) ATP phosphoribosyltransferase (EC 2.4.2.17) (ATP-PRTase)| (ATP-PRT) Length = 214 Score = 27.7 bits (60), Expect = 7.1 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 301 YVCTNHCCIFTKFDNVMYEMFDKK 372 Y + H + TK+ N+ YE F KK Sbjct: 103 YFSSTHISVATKYPNIAYEFFKKK 126
>ATPG_MYCPN (Q50330) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 279 Score = 27.3 bits (59), Expect = 9.2 Identities = 20/93 (21%), Positives = 41/93 (44%), Gaps = 5/93 (5%) Frame = +3 Query: 39 RGVLMDPSTETSDKVLETIIAVLKISLFSSVCIMLV*IKQLMVSDA-P*SVFPFDLVLVR 215 R + D + SD+++E + +CI+ K ++ A VFPFD+ + + Sbjct: 134 RDLSFDYCQQVSDQIMEQF----DLHQLDRICIIYTQFKNPLIQHANSFQVFPFDVAMFK 189 Query: 216 RFHLFPLREMYDL----HR*VQPNRPRFLDLSL 302 F+ + + D ++ P+F D++L Sbjct: 190 AFNPVKMEQKLDFEPDEETIIKLISPQFFDIAL 222 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,704,187 Number of Sequences: 219361 Number of extensions: 1010390 Number of successful extensions: 2043 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1926 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2043 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 1407308304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)