| Clone Name | baal27n24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GALM_PIG (Q9GKX6) Aldose 1-epimerase (EC 5.1.3.3) (Galactose mut... | 30 | 5.4 | 2 | SUHW_DROVI (Q08876) Protein suppressor of hairy wing | 30 | 5.4 | 3 | K1683_MACFA (Q8WNU4) Protein KIAA1683 homolog (Fragment) | 29 | 9.2 | 4 | SIA4B_PANTR (Q6KB58) CMP-N-acetylneuraminate-beta-galactosamide-... | 29 | 9.2 | 5 | SIA4B_HUMAN (Q16842) CMP-N-acetylneuraminate-beta-galactosamide-... | 29 | 9.2 |
|---|
>GALM_PIG (Q9GKX6) Aldose 1-epimerase (EC 5.1.3.3) (Galactose mutarotase)| Length = 342 Score = 29.6 bits (65), Expect = 5.4 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +3 Query: 54 TGAPYPSRCLSGYPLEAETWPAAVRQSY 137 TGA YP SG+ LE + WP AV Q + Sbjct: 294 TGAVYPKH--SGFCLETQNWPNAVNQPH 319
>SUHW_DROVI (Q08876) Protein suppressor of hairy wing| Length = 899 Score = 29.6 bits (65), Expect = 5.4 Identities = 19/65 (29%), Positives = 28/65 (43%), Gaps = 3/65 (4%) Frame = +2 Query: 23 RRKLETQARPYRCSLPISMF---IRLSS*GRDVAGGGAAELSGARCPRQIRAPGSESEYM 193 R +T RPY CSL I F +L +D A + C R R E++ Sbjct: 512 RTHSKTHLRPYACSLCIQKFKTEKQLERHVKDHTRQKRASFACTECTRSFRTSALLKEHL 571 Query: 194 DSGEY 208 D+G++ Sbjct: 572 DAGDH 576
>K1683_MACFA (Q8WNU4) Protein KIAA1683 homolog (Fragment)| Length = 798 Score = 28.9 bits (63), Expect = 9.2 Identities = 24/98 (24%), Positives = 39/98 (39%) Frame = +3 Query: 9 SLALDVGSSRPRRDLTGAPYPSRCLSGYPLEAETWPAAVRQSYQAQDAPDKSEHRDRRAS 188 S+ + VGSS G P+R + G A A R S + P + R R + Sbjct: 667 SVVMLVGSSPRTCHTCGRTQPTRVVQGMGRGAGGPGAVSRASAYQRAVPSPRQPRRRDKA 726 Query: 189 TWILESTCRMIKSSSKLKTSQVQVRPTQVIQMARSWRG 302 ++S R K +++ Q+ + Q +WRG Sbjct: 727 ATAIQSAWRGFKIRQQMRQQQMAAKMVQA-----TWRG 759
>SIA4B_PANTR (Q6KB58) CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,| 3-sialyltransferase (EC 2.4.99.-) (Beta-galactoside alpha-2,3-sialyltransferase) (Alpha 2,3-ST) (Gal-NAc6S) (Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase) (ST3GalA.2) (SIAT4-B) (S Length = 350 Score = 28.9 bits (63), Expect = 9.2 Identities = 20/45 (44%), Positives = 24/45 (53%) Frame = -2 Query: 160 LSGASCA**LCRTAAGHVSASRG*PDKHRDG*GAPVRSRLGLELP 26 LSG SCA CR G AS D H DG +PV +R ++LP Sbjct: 65 LSGKSCA---CRRCMGDAGASDWF-DSHFDGNISPVWTRENMDLP 105
>SIA4B_HUMAN (Q16842) CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,| 3-sialyltransferase (EC 2.4.99.-) (Beta-galactoside alpha-2,3-sialyltransferase) (Alpha 2,3-ST) (Gal-NAc6S) (Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase) (ST3GalA.2) (SIAT4-B) (S Length = 350 Score = 28.9 bits (63), Expect = 9.2 Identities = 20/45 (44%), Positives = 24/45 (53%) Frame = -2 Query: 160 LSGASCA**LCRTAAGHVSASRG*PDKHRDG*GAPVRSRLGLELP 26 LSG SCA CR G AS D H DG +PV +R ++LP Sbjct: 65 LSGKSCA---CRRCMGDAGASDWF-DSHFDGNISPVWTRENMDLP 105 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,012,402 Number of Sequences: 219361 Number of extensions: 1194163 Number of successful extensions: 3030 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2911 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3027 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4085413911 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)