| Clone Name | baal27h13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TP53B_MOUSE (P70399) Tumor suppressor p53-binding protein 1 (p53... | 32 | 1.8 | 2 | Y159_METJA (Q57623) Hypothetical protein MJ0159 | 29 | 9.2 | 3 | YNR6_YEAST (P53882) Hypothetical 67.4 kDa protein in RPS3-PSD1 i... | 29 | 9.2 |
|---|
>TP53B_MOUSE (P70399) Tumor suppressor p53-binding protein 1 (p53-binding protein| 1) (p53BP1) (53BP1) Length = 1957 Score = 31.6 bits (70), Expect = 1.8 Identities = 18/54 (33%), Positives = 24/54 (44%) Frame = +2 Query: 287 SPGDYHAVSPRFFGAPTQHHSTGSWPVRCSYGSSSDGDGAPPANFDASGEEFVD 448 S GD +S A + HH++ + + S S G GA P ASG E D Sbjct: 1280 SSGDLGDISSFSSKASSSHHTSSGTSLSAIHSSGSSGRGAGPLKGKASGTEAAD 1333
>Y159_METJA (Q57623) Hypothetical protein MJ0159| Length = 542 Score = 29.3 bits (64), Expect = 9.2 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = +2 Query: 380 GSSSDGDGAPPANFDASGEEFVD--SSVMEAVELRCV 484 G +G+G PANF G EF++ +++E EL+C+ Sbjct: 214 GIIENGEGYLPANFRYFGVEFLERFETILEIDELKCI 250
>YNR6_YEAST (P53882) Hypothetical 67.4 kDa protein in RPS3-PSD1 intergenic| region Length = 636 Score = 29.3 bits (64), Expect = 9.2 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = -1 Query: 522 FLPSRILITKPSDTHLSSTASMTLESTNSSPLASKFAGGAPSPS 391 F PS + PS T+LSS ++ + + + +S L+S + SPS Sbjct: 199 FSPSTPTVISPSYTYLSSISATSFQISTTSELSSSWFSTISSPS 242 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,925,992 Number of Sequences: 219361 Number of extensions: 1561411 Number of successful extensions: 4461 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4258 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4459 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5310515667 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)