| Clone Name | baal26h05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MBD1_MOUSE (Q9Z2E2) Methyl-CpG-binding domain protein 1 (Methyl-... | 28 | 4.8 | 2 | SALL3_MOUSE (Q62255) Sal-like protein 3 (Spalt-like protein 3) (... | 28 | 8.1 | 3 | END4_MESFL (Q6F1D3) Probable endonuclease 4 (EC 3.1.21.2) (Endon... | 28 | 8.1 |
|---|
>MBD1_MOUSE (Q9Z2E2) Methyl-CpG-binding domain protein 1 (Methyl-CpG-binding| protein MBD1) Length = 636 Score = 28.5 bits (62), Expect = 4.8 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = -1 Query: 133 PVTKPTLHVTVNMGAISPAEYSTQATSKITSCCSSLGFHFA 11 P ++V+ A S A S A+S CC + G HF+ Sbjct: 119 PTATALASLSVSASASSSASASASASSHAPVCCENCGIHFS 159
>SALL3_MOUSE (Q62255) Sal-like protein 3 (Spalt-like protein 3) (MSal)| (Fragment) Length = 1323 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -1 Query: 139 QLPVTKPTLHVTVNMGAISPAEYSTQATSKITSCCSSL 26 QLP T P H + +I+P S Q S +S C+SL Sbjct: 507 QLPPTVPGTHNYTDSPSITPVSRSPQRPSPASSECTSL 544
>END4_MESFL (Q6F1D3) Probable endonuclease 4 (EC 3.1.21.2) (Endonuclease IV)| (Endodeoxyribonuclease IV) Length = 293 Score = 27.7 bits (60), Expect = 8.1 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = -3 Query: 143 KPVTGDQTHFTRDCKHGGY*PSGVQHPGHFQNYVMLFVTGFP 18 KP+ G ++ KHG Y V+ ++ ++F TG P Sbjct: 3 KPILGSHVGMSKSNKHGEYLIGSVKEALSYEANTLMFYTGAP 44 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,095,669 Number of Sequences: 219361 Number of extensions: 562974 Number of successful extensions: 1333 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1309 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1333 length of database: 80,573,946 effective HSP length: 61 effective length of database: 67,192,925 effective search space used: 1612630200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)