| Clone Name | baal26f01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ICS_CATRO (Q9ZPC0) Isochorismate synthase, chloroplast precursor... | 32 | 0.45 | 2 | MAML3_HUMAN (Q96JK9) Mastermind-like protein 3 (Mam-3) | 28 | 5.0 | 3 | Y1659_METJA (Q59053) Hypothetical ATP-binding protein MJ1659 | 28 | 6.6 | 4 | Y1006_METJA (Q58412) Hypothetical ATP-binding protein MJ1006 | 28 | 6.6 | 5 | Y3526_METJA (Q60285) Hypothetical ATP-binding protein MJECL26 | 28 | 8.6 | 6 | K0971_MOUSE (Q922E6) Protein KIAA0971 homolog | 28 | 8.6 |
|---|
>ICS_CATRO (Q9ZPC0) Isochorismate synthase, chloroplast precursor (EC 5.4.4.2)| Length = 580 Score = 32.0 bits (71), Expect = 0.45 Identities = 18/40 (45%), Positives = 22/40 (55%) Frame = +1 Query: 37 DKNLFAVCLFGDSVRRRDP*QWSSD*WLCILWFVCLNCCL 156 DKNL +V G +V R P +S D WL I F+ NC L Sbjct: 173 DKNLVSVAGVGSAVLFRSPNPFSFDDWLSIKRFLSKNCPL 212
>MAML3_HUMAN (Q96JK9) Mastermind-like protein 3 (Mam-3)| Length = 1133 Score = 28.5 bits (62), Expect = 5.0 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = -1 Query: 135 EPEYTQPLIRTPLSWISSTYRVSE*THSKEIFIEV---QREPGSTG 7 EPE++QP TPLS S++ + S+ +HS + + Q P S+G Sbjct: 338 EPEFSQPATETPLSQESASVK-SDPSHSPFAHVSMGSPQARPSSSG 382
>Y1659_METJA (Q59053) Hypothetical ATP-binding protein MJ1659| Length = 361 Score = 28.1 bits (61), Expect = 6.6 Identities = 9/26 (34%), Positives = 19/26 (73%) Frame = +2 Query: 50 LLCVYSETLYVEEIHDNGVLINGCVY 127 +LC+ S++L++E +++ G L + C Y Sbjct: 191 VLCLSSDSLFIERVYNEGTLKDRCKY 216
>Y1006_METJA (Q58412) Hypothetical ATP-binding protein MJ1006| Length = 359 Score = 28.1 bits (61), Expect = 6.6 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +2 Query: 50 LLCVYSETLYVEEIHDNGVLINGCVY 127 ++C+ S+TL++EEI+ N L N Y Sbjct: 192 VICLTSDTLFIEEIYRNSTLENTSEY 217
>Y3526_METJA (Q60285) Hypothetical ATP-binding protein MJECL26| Length = 343 Score = 27.7 bits (60), Expect = 8.6 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +2 Query: 50 LLCVYSETLYVEEIHDNGVLINGCVY 127 ++C+ S+TL+++EI+ N L N Y Sbjct: 174 VICLTSDTLFIDEIYRNSTLKNASEY 199
>K0971_MOUSE (Q922E6) Protein KIAA0971 homolog| Length = 689 Score = 27.7 bits (60), Expect = 8.6 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 6/47 (12%) Frame = +2 Query: 17 PGSLCTSIKISLLCVYSETLYVEEIHDNGVL------INGCVYSGSS 139 PGSL +S+L VYS +V +IH+ L + GC++ SS Sbjct: 434 PGSLNVKNIVSILHVYSSLNHVHKIHNREFLEALASALTGCLHHISS 480 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,094,754 Number of Sequences: 219361 Number of extensions: 466877 Number of successful extensions: 1237 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1233 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1237 length of database: 80,573,946 effective HSP length: 43 effective length of database: 71,141,423 effective search space used: 1707394152 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)