| Clone Name | baal26c13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NUOL_CAMJE (Q9PMA7) NADH-quinone oxidoreductase chain L (EC 1.6.... | 30 | 2.2 | 2 | YDD3_SCHPO (O14206) Hypothetical protein C1B9.03c in chromosome I | 28 | 8.5 |
|---|
>NUOL_CAMJE (Q9PMA7) NADH-quinone oxidoreductase chain L (EC 1.6.99.5) (NADH| dehydrogenase I, chain L) (NDH-1, chain L) Length = 596 Score = 29.6 bits (65), Expect = 2.2 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = -2 Query: 152 ISPLYISSIATSFLHHSYSSQLINQLQLLVEKSSIILIC 36 +SPL + +I F HS+ L +L + ++ I++IC Sbjct: 446 MSPLMVLAIIAGFFEHSFFEYLSTKLVFIDAQNQIVMIC 484
>YDD3_SCHPO (O14206) Hypothetical protein C1B9.03c in chromosome I| Length = 389 Score = 27.7 bits (60), Expect = 8.5 Identities = 16/57 (28%), Positives = 30/57 (52%) Frame = -1 Query: 174 LTECFRTYLPPIHIKHSNQFSSP*LQLTAN*STSIAGRKEQHYINM*TRGFILSSQP 4 LT F+ PPI ++H+N + + + R++ YI++ R FI+S++P Sbjct: 159 LTTTFQNMFPPISVQHTN--------INSVKRVLLLNRRDDGYIDL--RHFIISTKP 205 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,767,688 Number of Sequences: 219361 Number of extensions: 372312 Number of successful extensions: 712 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 699 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 712 length of database: 80,573,946 effective HSP length: 46 effective length of database: 70,483,340 effective search space used: 1691600160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)