| Clone Name | baal25m12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KAPP_ARATH (P46014) Kinase-associated protein phosphatase (EC 3.... | 67 | 3e-11 | 2 | RL2_TOBAC (P25998) 60S ribosomal protein L2 | 30 | 6.4 | 3 | RIMM_RALSO (Q8Y0V9) Probable 16S rRNA-processing protein rimM | 29 | 8.3 |
|---|
>KAPP_ARATH (P46014) Kinase-associated protein phosphatase (EC 3.1.3.16)| Length = 581 Score = 67.4 bits (163), Expect = 3e-11 Identities = 33/56 (58%), Positives = 41/56 (73%) Frame = +1 Query: 208 SHLTLEVIAGPSHGINRYLQSGNTSMLPMTLGRIPQSDLVFKDSEVSGKHARIDWN 375 S L LEVIAGP+ G+ + S ++S LP+ LGR+ SDL KDSEVSGKHA+I WN Sbjct: 180 SWLFLEVIAGPAIGLQHAVNSTSSSKLPVKLGRVSPSDLALKDSEVSGKHAQITWN 235
>RL2_TOBAC (P25998) 60S ribosomal protein L2| Length = 260 Score = 29.6 bits (65), Expect = 6.4 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 1/62 (1%) Frame = +1 Query: 109 NVLSLAGCPSGPYVANIIHAYAHDI*SFARSAGSHLTLEVIAGPSHGINRY-LQSGNTSM 285 NVL L P G V N+ H D FAR +G++ + + P +G R L SG+ + Sbjct: 100 NVLPLRSIPEGAVVCNVEHKVG-DRGVFARCSGAY-AIVISHNPDNGTTRIKLPSGSKKI 157 Query: 286 LP 291 +P Sbjct: 158 VP 159
>RIMM_RALSO (Q8Y0V9) Probable 16S rRNA-processing protein rimM| Length = 184 Score = 29.3 bits (64), Expect = 8.3 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 4/56 (7%) Frame = +1 Query: 217 TLEVIAG----PSHGINRYLQSGNTSMLPMTLGRIPQSDLVFKDSEVSGKHARIDW 372 TL +AG +H I R + G T L +P ++ K +V+GKH +DW Sbjct: 131 TLGTVAGLIDNGAHQILRIVDEGGTERL------VPFVEVYVKSVDVAGKHIVVDW 180 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,371,015 Number of Sequences: 219361 Number of extensions: 1560356 Number of successful extensions: 3128 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2939 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3097 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4815021120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)