| Clone Name | baal25l10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CF105_HUMAN (Q96IZ2) Protein C6orf105 | 32 | 0.55 | 2 | TNP6_ENTFC (Q06238) Transposase for transposon Tn1546 | 29 | 3.5 | 3 | DGK3_CAEEL (Q03603) Probable diacylglycerol kinase 3 (EC 2.7.1.1... | 28 | 7.9 | 4 | POLG_HRV1B (P12916) Genome polyprotein [Contains: Coat protein V... | 28 | 7.9 |
|---|
>CF105_HUMAN (Q96IZ2) Protein C6orf105| Length = 230 Score = 31.6 bits (70), Expect = 0.55 Identities = 22/71 (30%), Positives = 32/71 (45%) Frame = +1 Query: 7 WQGKVPYWESYEPG*GNKDDSKSSFQA*GLSLMEITFLCLLMRIY*YGRRKLKDILSQAK 186 W + Y+ S E KD+ K A G +T L LL++ YG L D+L + K Sbjct: 16 WYTFLNYYISQE----GKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTK 71 Query: 187 LXKSVKFYNIY 219 K +KF + Sbjct: 72 GGKDIKFLTAF 82
>TNP6_ENTFC (Q06238) Transposase for transposon Tn1546| Length = 988 Score = 28.9 bits (63), Expect = 3.5 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +3 Query: 117 PLPLNEDILIWAKETQGYLIPGKAXKISEVLQYLR 221 P N+ IL W KE G+ P KI E L+Y+R Sbjct: 205 PSESNKTILGWLKEPPGHPSPETFLKIIERLEYIR 239
>DGK3_CAEEL (Q03603) Probable diacylglycerol kinase 3 (EC 2.7.1.107)| (Diglyceride kinase 3) (DGK-3) (DAG kinase 3) Length = 812 Score = 27.7 bits (60), Expect = 7.9 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +1 Query: 145 YGRRKLKDILSQAKLXKSVKFYNIYGIDYET 237 Y RRKLKD+LS + KFY+ +D +T Sbjct: 17 YSRRKLKDMLSD--FQQDGKFYSYLSVDGQT 45
>POLG_HRV1B (P12916) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2156 Score = 27.7 bits (60), Expect = 7.9 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = -2 Query: 128 KRQRNVISIRDNPHAWKELFESSLLPHPGSYDSQYGTFPC 9 K + I+ PH W E+ ES P Y+ G PC Sbjct: 918 KHKNRYYPIKVTPHDWYEIQESEYYPKHIQYNLLIGEGPC 957 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,175,982 Number of Sequences: 219361 Number of extensions: 688605 Number of successful extensions: 1615 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1600 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1615 length of database: 80,573,946 effective HSP length: 69 effective length of database: 65,438,037 effective search space used: 1570512888 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)