| Clone Name | baal26a06 |
|---|---|
| Clone Library Name | barley_pub |
>S28A2_HUMAN (O43868) Sodium/nucleoside cotransporter 2 (Na(+)/nucleoside| cotransporter 2) (Sodium-coupled nucleoside transporter 2) (Concentrative nucleoside transporter 2) (CNT 2) (hCNT2) (Sodium/purine nucleoside co-transporter) (SPNT) Length = 658 Score = 32.3 bits (72), Expect = 1.3 Identities = 51/199 (25%), Positives = 81/199 (40%), Gaps = 11/199 (5%) Frame = +2 Query: 80 LCLVAAACTLLSTVCNFQVFLLSDDDGFTNKEISEFV-TGTMEFAICYSYIFLKLHELIL 256 LCL AA L + + NFQ + ++ FV T + F + +S++ L + + Sbjct: 85 LCLAYAAYLLAACILNFQ------------RALALFVITCLVIFVLVHSFLKKLLGKKLT 132 Query: 257 PNFAP-----LKSWIKWGRNFRIFRDTGVFVTISYLLLLDISWRFVSLAIFPVMAIAFIG 421 P L+ W KW VF +S + L I W + A P I F G Sbjct: 133 RCLKPFENSRLRLWTKW-----------VFAGVSLVGL--ILWLALDTAQRPEQLIPFAG 179 Query: 422 ALYFKLDPHTGDISRKVTGRSSKVDEKTIRTPVKLQIIVVATFGALLVMDQLDDDTAMGF 601 F L I + S V +T+ + + LQ + FG L++ T +G+ Sbjct: 180 ICMFIL------ILFACSKHHSAVSWRTVFSGLGLQFV----FGILVIR------TDLGY 223 Query: 602 AISQFL-----LFLSSTVA 643 + Q+L +FL+ TVA Sbjct: 224 TVFQWLGEQVQIFLNYTVA 242
>ZN490_HUMAN (Q9ULM2) Zinc finger protein 490| Length = 529 Score = 31.2 bits (69), Expect = 2.9 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 568 HHQQRPECCHHYDLKLHRCPDC 503 H +Q+P CH Y K H+C +C Sbjct: 178 HTEQKPNECHEYGEKPHKCKEC 199
>COX3_CANPA (Q34214) Cytochrome c oxidase subunit 3 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide III) (Cytochrome oxidase subunit 3) Length = 269 Score = 30.8 bits (68), Expect = 3.8 Identities = 14/52 (26%), Positives = 26/52 (50%) Frame = +2 Query: 239 LHELILPNFAPLKSWIKWGRNFRIFRDTGVFVTISYLLLLDISWRFVSLAIF 394 LH ++L + +W + +F G TI YL +LD+ W F+ + ++ Sbjct: 214 LHMIMLTIMLVICTWRVYNYDFTNTSHVGAETTILYLHVLDVIWLFIYIIVY 265
>FAT2_RAT (O88277) Protocadherin Fat 2 precursor (Multiple epidermal growth| factor-like domains 1) Length = 4351 Score = 25.8 bits (55), Expect(2) = 4.2 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 Query: 428 YFKLDPHTGDISRK 469 YF++DP+ GDIS K Sbjct: 2115 YFRIDPYVGDISLK 2128 Score = 23.1 bits (48), Expect(2) = 4.2 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 282 GSNGVVTSGFSETRAFL*LYP 344 G+NG VT GF+E A+ + P Sbjct: 2100 GANGSVTYGFAEDYAYFRIDP 2120
>PHC1_MOUSE (Q64028) Polyhomeotic-like protein 1 (mPH1) (Early development| regulatory protein 1) (RAE-28) Length = 1012 Score = 30.4 bits (67), Expect = 5.0 Identities = 26/99 (26%), Positives = 40/99 (40%), Gaps = 6/99 (6%) Frame = -1 Query: 547 CCHHYDLKLHRCPD----CFLVDLRRSPRNFATDVACMRIELEVQCSYESNGHDGKDGKR 380 C H + LK + + + RR PR ++D+A +I+ + E + + Sbjct: 839 CSHQFRLKRKKMKEFQEASYARVRRRGPRRSSSDIARAKIQGKRHRGQEDSSRGSDNSSY 898 Query: 379 DE--SPTDVQ**QVGYSHKNARVSENPEVTTPFDPRLQG 269 DE SPT V H + +TTP P LQG Sbjct: 899 DEALSPTSPGPLSVRAGHGERDLGNT--ITTPSTPELQG 935
>GP111_HUMAN (Q8IZF7) Probable G-protein coupled receptor 111 (G-protein coupled| receptor PGR20) Length = 708 Score = 30.0 bits (66), Expect = 6.5 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 2/65 (3%) Frame = +2 Query: 431 FKLDPHTGDISRKVTGRSSKVDEKTIRTPVKLQIIVVA--TFGALLVMDQLDDDTAMGFA 604 F D S +VTGR ++ + P Q+I +A T GA+L L++ T G Sbjct: 306 FTFSMRINDTSNEVTGRVLISRDELRKVPSPSQVISIAFPTIGAILEASLLENVTVNGLV 365 Query: 605 ISQFL 619 +S L Sbjct: 366 LSAIL 370
>ABCG3_MOUSE (Q99P81) ATP-binding cassette sub-family G member 3| Length = 650 Score = 30.0 bits (66), Expect = 6.5 Identities = 14/56 (25%), Positives = 27/56 (48%) Frame = +2 Query: 197 TMEFAICYSYIFLKLHELILPNFAPLKSWIKWGRNFRIFRDTGVFVTISYLLLLDI 364 T E + C++Y+ E ++ L SW W + + + +TI+Y+ LL + Sbjct: 589 TEEVSRCHNYVICTGEEFLMIQGIDLSSWGFWENHLALVCTMIILLTITYVQLLQV 644
>YMA2_YEAST (Q04263) Hypothetical 84.6 kDa protein in GLO1-YPT7 intergenic| region Length = 737 Score = 29.6 bits (65), Expect = 8.5 Identities = 15/57 (26%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = -1 Query: 523 LHRCPDCF--LVDLRRSPRNFATDVACMRIELEVQCSYESNGHDGKDGKRDESPTDV 359 LH+ +CF L+ L++ P N TD A + + + S + GK+ + P ++ Sbjct: 462 LHQLTNCFNVLLFLKKIPENLFTDEASILYWMRINTSKRNQKPSGKENPKTMEPEEI 518 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,600,780 Number of Sequences: 219361 Number of extensions: 1855287 Number of successful extensions: 5068 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 4923 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5067 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6427774254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)