| Clone Name | baal25l05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | C4D21_DROME (Q9VLZ7) Probable cytochrome P450 4d21 (EC 1.14.-.-)... | 32 | 1.3 | 2 | GLMM_PROMP (Q7V349) Phosphoglucosamine mutase (EC 5.4.2.10) | 30 | 6.7 | 3 | RBP2_PLAVB (Q00799) Reticulocyte-binding protein 2 precursor (Pv... | 30 | 6.7 | 4 | TGM4_HUMAN (P49221) Protein-glutamine gamma-glutamyltransferase ... | 29 | 8.7 |
|---|
>C4D21_DROME (Q9VLZ7) Probable cytochrome P450 4d21 (EC 1.14.-.-) (CYPIVD21)| Length = 511 Score = 32.0 bits (71), Expect = 1.3 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 5/60 (8%) Frame = +2 Query: 356 LIQTK*KRNMPSILSSQSL*KQAHL-----QLVYFNHLVSVSHRQTMRRNIMAQTLFMRC 520 LI TK + SILSS +L K+AHL + L+S ++ T RR ++A +C Sbjct: 80 LIYTKDLKYFESILSSSTLLKKAHLYRFLRDFLGDGLLLSTGNKWTSRRKVLAPAFHFKC 139
>GLMM_PROMP (Q7V349) Phosphoglucosamine mutase (EC 5.4.2.10)| Length = 452 Score = 29.6 bits (65), Expect = 6.7 Identities = 22/103 (21%), Positives = 47/103 (45%) Frame = +1 Query: 178 LLGRNGTSLTSMPRKQLSMLLVESDSWDLKRDIPLRTRFSEMKQNGCESVFPQVILLALA 357 + NG + Q+ ++L +++ LK +T E N +++ + ++ + Sbjct: 108 IFDNNGEKIKKKLENQIELILETANN--LKLSTYKKTSIRE--NNNLFNIYTEGLINTMG 163 Query: 358 DSDKMKAEYAIDSVITKPLKASTLAACLFQSLGISITQANNEK 486 D + + +D+ A+T AA +FQ LG ++ NNE+ Sbjct: 164 DENLDGMKIVLDTCYGS---ATTCAASIFQKLGANVKVINNEQ 203
>RBP2_PLAVB (Q00799) Reticulocyte-binding protein 2 precursor (PvRBP-2)| Length = 2867 Score = 29.6 bits (65), Expect = 6.7 Identities = 23/100 (23%), Positives = 45/100 (45%), Gaps = 4/100 (4%) Frame = +1 Query: 94 GATVTEYHLQRLGIASKSVRTIEQALSVLLGRNGTSLTSMPRKQLSMLLVESDSWDLKRD 273 G T Y+ ++ A++S IEQ +++ + GTS TS +L +K + Sbjct: 1287 GDTSNFYYTEQYNSATQSKAKIEQFINIATTKKGTSDTSQDINELE---------SIKEE 1337 Query: 274 IPLRTRFSEMKQNGCESVFPQVI----LLALADSDKMKAE 381 + + + + N E + Q++ LL L +S+ + E Sbjct: 1338 VHKNLQLVKQESNSMEEMRKQILSMKDLLILNNSETIAKE 1377
>TGM4_HUMAN (P49221) Protein-glutamine gamma-glutamyltransferase 4 (EC| 2.3.2.13) (Transglutaminase-4) (TGase-4) (Prostate transglutaminase) (TGP) (TG(P)) (Prostate-specific transglutaminase) (Fibrinoligase) Length = 684 Score = 29.3 bits (64), Expect = 8.7 Identities = 20/78 (25%), Positives = 34/78 (43%), Gaps = 8/78 (10%) Frame = +1 Query: 70 CWLIKDQ*GATVTEYHLQRLGIASKSVRTIEQA--------LSVLLGRNGTSLTSMPRKQ 225 CW+ A + L+ LGI ++SV + A + + NG +TSM Sbjct: 268 CWVF-----AGILTTVLRALGIPARSVTGFDSAHDTERNLTVDTYVNENGEKITSMTHDS 322 Query: 226 LSMLLVESDSWDLKRDIP 279 + V +D+W + D+P Sbjct: 323 VWNFHVWTDAWMKRPDLP 340 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,415,775 Number of Sequences: 219361 Number of extensions: 1661909 Number of successful extensions: 3620 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3558 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3620 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5044307840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)