| Clone Name | baal25k03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YJK3_YEAST (P42950) Putative 70.4 kDa transcriptional regulatory... | 32 | 1.5 | 2 | LGT_MYCGA (Q7NAE3) Prolipoprotein diacylglyceryl transferase (EC... | 30 | 3.4 | 3 | FCGR1_HUMAN (P12314) High affinity immunoglobulin gamma Fc recep... | 29 | 7.6 |
|---|
>YJK3_YEAST (P42950) Putative 70.4 kDa transcriptional regulatory protein in| IME2-MEF2 intergenic region Length = 618 Score = 31.6 bits (70), Expect = 1.5 Identities = 24/74 (32%), Positives = 36/74 (48%), Gaps = 6/74 (8%) Frame = +3 Query: 57 MIKAHNYKDVRTKL--TLTNLFVSDK*INESKKVRDTHN*EGGSFFF*YN*RYRQL*ERY 230 +IK HNYK TKL TL F+ I++S V+D H+ + + + R + ERY Sbjct: 380 LIKPHNYKLAYTKLLTTLRKKFLEGAEIDKSASVKDEHSTQKHNLRYDLEVIIRSILERY 439 Query: 231 ----FSFSGKLIRE 260 S + +I E Sbjct: 440 APIFISLTSNMIEE 453
>LGT_MYCGA (Q7NAE3) Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)| Length = 369 Score = 30.4 bits (67), Expect = 3.4 Identities = 22/82 (26%), Positives = 38/82 (46%) Frame = +2 Query: 185 LFLIQLEIQTIMREILFFFWKANKGITRIYNKCTLHCENLSKNKYTLYKKMKVVEIRTRS 364 LFL+ I I + +F ++ K ++NK ++ L KN YK + EIR + Sbjct: 282 LFLLGGSIGFIFTQWIFPRFRNKKNYFFLFNKVKIYFIGLFKNYLNKYKNLTKEEIRKKL 341 Query: 365 VTATYFYKNPSFKIIFFLISCY 430 ++ Y + +F +FF Y Sbjct: 342 EPSSTIY-SKNFSEMFFYADDY 362
>FCGR1_HUMAN (P12314) High affinity immunoglobulin gamma Fc receptor I precursor| (Fc-gamma RI) (FcRI) (IgG Fc receptor I) (CD64 antigen) Length = 374 Score = 29.3 bits (64), Expect = 7.6 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = +2 Query: 233 FFFWKANKGI--TRIYNKCTLHCENLSKNKYT 322 FF W +N I T I + T HC + K++YT Sbjct: 146 FFHWNSNLTILKTNISHNGTYHCSGMGKHRYT 177 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,636,607 Number of Sequences: 219361 Number of extensions: 1319580 Number of successful extensions: 2570 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2537 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2570 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4373119116 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)