| Clone Name | baal25j12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PUR4_DROME (P35421) Phosphoribosylformylglycinamidine synthase (... | 32 | 0.94 | 2 | P200_MYCPN (P75211) Protein P200 | 30 | 3.6 | 3 | TRAJ9_ECOLI (Q00738) Protein traJ | 30 | 4.6 | 4 | STU1_YEAST (P38198) Mitotic spindle protein STU1 | 30 | 4.6 | 5 | RLUB_XANAC (Q8PK58) Ribosomal large subunit pseudouridine syntha... | 30 | 4.6 | 6 | IF2_STRAW (Q82K53) Translation initiation factor IF-2 | 29 | 7.9 | 7 | YAED_SCHPO (Q09853) Hypothetical protein C23D3.13c in chromosome I | 29 | 7.9 |
|---|
>PUR4_DROME (P35421) Phosphoribosylformylglycinamidine synthase (EC 6.3.5.3)| (FGAM synthase) (FGAMS) (Formylglycinamide ribotide amidotransferase) (FGARAT) (Formylglycinamide ribotide synthetase) (Adenosine-2) Length = 1354 Score = 32.3 bits (72), Expect = 0.94 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +3 Query: 138 GSARTRPATCSTRFKLSLKSMSFAPEASEEVPPLGFKRTPCIFSK 272 G + R STR+ ++ S APEA+ VP LG + T C++++ Sbjct: 112 GYSEVRRMETSTRYLVTFGEGSKAPEAARFVPLLGDRMTQCLYTE 156
>P200_MYCPN (P75211) Protein P200| Length = 1036 Score = 30.4 bits (67), Expect = 3.6 Identities = 18/88 (20%), Positives = 42/88 (47%), Gaps = 3/88 (3%) Frame = +1 Query: 304 IKRDVCDKLVESLCSKRKDHFVYDPLSTSESSSFRNDNTCDELDLRIASVLQSTGHHYEG 483 +K+ + + ++ K++ F+ P TS + R+DN E + ++ Q+ HY Sbjct: 73 VKKQIVESSIDFFDEKKRGVFIVPPAGTSVINDDRDDNKAVEETVSKTAISQNQLAHYAN 132 Query: 484 GFWDDGQKYD---VADKRHVAIVTTRQS 558 + ++++ VA + + + +TR S Sbjct: 133 SELVETEQFELKPVALEHNQVLTSTRHS 160
>TRAJ9_ECOLI (Q00738) Protein traJ| Length = 215 Score = 30.0 bits (66), Expect = 4.6 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = -3 Query: 278 DCFRKYARSSFKS--QWWYFLRCFRCKAHRFQAELEPC 171 +CF K RSSF S +W+ L+ CK +AE+E C Sbjct: 46 NCFEKLIRSSFNSCDEWFDSLK-LECKLQLSRAEIESC 82
>STU1_YEAST (P38198) Mitotic spindle protein STU1| Length = 1513 Score = 30.0 bits (66), Expect = 4.6 Identities = 11/47 (23%), Positives = 22/47 (46%) Frame = -3 Query: 335 STNLSHTSLFIPSWSNNGPDCFRKYARSSFKSQWWYFLRCFRCKAHR 195 ++ L + ++I W G + R + + +WYF +C+ A R Sbjct: 499 TSKLENNIIYIEEWLKKGISDSQTTVREAMRLTFWYFYKCYPTNAKR 545
>RLUB_XANAC (Q8PK58) Ribosomal large subunit pseudouridine synthase B (EC| 5.4.99.-) (rRNA-uridine isomerase B) (rRNA pseudouridylate synthase B) Length = 550 Score = 30.0 bits (66), Expect = 4.6 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +1 Query: 106 GRQGAPQGPRPEAPGPGQRRAPQGSS 183 G GAP+GP PG G RR P G + Sbjct: 522 GPGGAPRGPGGRPPGGGNRRPPGGGN 547
>IF2_STRAW (Q82K53) Translation initiation factor IF-2| Length = 1046 Score = 29.3 bits (64), Expect = 7.9 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +1 Query: 106 GRQGAPQGPRPEAPGPGQRRAPQ 174 G GAP GPRP+ G GQ RAP+ Sbjct: 242 GGAGAPGGPRPQGAG-GQDRAPR 263
>YAED_SCHPO (Q09853) Hypothetical protein C23D3.13c in chromosome I| Length = 1616 Score = 29.3 bits (64), Expect = 7.9 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = +1 Query: 268 LKQSGPLFDQLGIKRDVCDKLVESLCSKRKDHFVYDPLSTSESSSFRNDNTCDELDLRIA 447 L++S +F I VC ++ + DH + +S S S F+ N EL R A Sbjct: 768 LRKSSEVFYSFSILETVCSCNLDRFLDSKLDHSGWSLISKSLSEVFKIINVAPELRTRAA 827 Query: 448 SVL 456 + L Sbjct: 828 NCL 830 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,845,675 Number of Sequences: 219361 Number of extensions: 1347213 Number of successful extensions: 5029 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4626 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5015 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4585734400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)