| Clone Name | baal25h16 |
|---|---|
| Clone Library Name | barley_pub |
>YDC9_SCHPO (Q10172) Hypothetical protein C25G10.09c in chromosome I| Length = 1794 Score = 30.4 bits (67), Expect = 2.2 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -3 Query: 367 MPMIVRGNP*VSIRADHSEPGRRLKYAPNPYDKREPPIPSPITP 236 + M G P +++ A S P NP+ K +PP PSP+ P Sbjct: 1602 LAMNAAGQPSLAVPAVPSAPSNHF----NPFAKMQPPAPSPLQP 1641
>PROP1_CEBAP (Q3LU40) Homeobox protein prophet of Pit-1 (PROP-1)| (Pituitary-specific homeodomain factor) Length = 226 Score = 29.3 bits (64), Expect = 4.8 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = +2 Query: 29 PGSCCAPGAILLPPPGEKCFPYAMPYESHRCAGPSCG 139 PGS P + PPP CFP+ PY + PS G Sbjct: 148 PGSPAGPYSYTTPPPPVTCFPH--PYSHDFPSQPSTG 182
>CD38_MACFA (Q5VAN0) ADP-ribosyl cyclase 1 (EC 3.2.2.5) (Cyclic ADP-ribose| hydrolase 1) (cADPr hydrolase 1) (CD38 homolog) Length = 301 Score = 28.9 bits (63), Expect = 6.3 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 4/41 (9%) Frame = +3 Query: 315 EWSALMLTYGFPLTIIGMALKYAELKP----VPCITYSDAF 425 +WS T FP T++ +KY E+ P V C + DAF Sbjct: 50 QWSGSGTTSRFPETVLARCVKYTEVHPEMRHVDCQSVWDAF 90
>NAPH_ECOLI (P33934) Ferredoxin-type protein napH| Length = 287 Score = 28.9 bits (63), Expect = 6.3 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 4/29 (13%) Frame = +2 Query: 245 WTRDRWLPL----VVWIWGVFQSSPWFGV 319 W RWL L ++ G+F S PWFGV Sbjct: 19 WRSHRWLVLRRLCQFFVLGMFLSGPWFGV 47
>CD38_HUMAN (P28907) ADP-ribosyl cyclase 1 (EC 3.2.2.5) (Cyclic ADP-ribose| hydrolase 1) (cADPr hydrolase 1) (Lymphocyte differentiation antigen CD38) (T10) (Acute lymphoblastic leukemia cells antigen CD38) Length = 300 Score = 28.9 bits (63), Expect = 6.3 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 4/41 (9%) Frame = +3 Query: 315 EWSALMLTYGFPLTIIGMALKYAELKP----VPCITYSDAF 425 +WS T FP T++ +KY E+ P V C + DAF Sbjct: 49 QWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAF 89
>FOG1_HUMAN (Q8IX07) Zinc finger protein ZFPM1 (Zinc finger protein multitype| 1) (Friend of GATA protein 1) (Friend of GATA-1) (FOG-1) Length = 1004 Score = 28.5 bits (62), Expect = 8.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 319 HSEPGRRLKYAPNPYDKREPPIPSPITPKDTLAR 218 H P RR P P PP PSP P T R Sbjct: 708 HDPPPRRPAAPPGPPGPAAPPAPSPAAPVRTRRR 741
>NHRF2_RAT (Q920G2) Na(+)/H(+) exchange regulatory cofactor NHE-RF2 (NHERF-2)| (Tyrosine kinase activator protein 1) (TKA-1) (SRY-interacting protein 1) (SIP-1) (Solute carrier family 9 isoform A3 regulatory factor 2) (NHE3 kinase A regulatory protein E3KA Length = 337 Score = 28.5 bits (62), Expect = 8.2 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = -3 Query: 304 RRLKYAPNPYDKREPPIPSPITPKDTLARVNSSS 203 +RL+ P D E P+PSP+T +LA++N S Sbjct: 237 KRLRVVPTE-DHVEGPLPSPVTNGTSLAQLNGGS 269
>MOT3_RAT (O70461) Monocarboxylate transporter 3 (MCT 3)| Length = 492 Score = 28.5 bits (62), Expect = 8.2 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 38 CCAPGAILLPPPGEKCFPYAMP 103 CCA GA++ PPPG + P P Sbjct: 187 CCACGAVMRPPPGPQPRPDPAP 208
>INSM1_MOUSE (Q63ZV0) Insulinoma-associated protein 1 (Zinc finger protein IA-1)| Length = 521 Score = 28.5 bits (62), Expect = 8.2 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = +2 Query: 14 HCKLTPGSCCAPGAILLPPPGEKCFPYAMPYESH 115 H L CAPG PPPG + + P +H Sbjct: 64 HAALAAALACAPGPPPPPPPGPRAAHFGNPEAAH 97 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,302,433 Number of Sequences: 219361 Number of extensions: 1192217 Number of successful extensions: 4549 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 4353 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4543 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)