| Clone Name | baal25g19 |
|---|---|
| Clone Library Name | barley_pub |
>NPT1_HUMAN (Q14916) Renal sodium-dependent phosphate transport protein 1| (Sodium/phosphate cotransporter 1) (Na(+)/PI cotransporter 1) (Renal sodium-phosphate transport protein 1) (Renal Na(+)-dependent phosphate cotransporter 1) (Solute carrier family 1 Length = 465 Score = 30.0 bits (66), Expect = 1.5 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +3 Query: 129 YCILLPSSTLAATLPYPAVFLICLAAGCXIC--WF 227 + +LL + + +L +P VF I A GC +C WF Sbjct: 181 FIVLLVTGVICESLGWPMVFYIFGACGCAVCLLWF 215
>NPT1_RABIT (Q28722) Renal sodium-dependent phosphate transport protein 1| (Sodium/phosphate cotransporter 1) (Na(+)/PI cotransporter 1) (Renal sodium-phosphate transport protein 1) (Renal Na(+)-dependent phosphate cotransporter 1) (Solute carrier family 1 Length = 465 Score = 29.6 bits (65), Expect = 1.9 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +3 Query: 129 YCILLPSSTLAATLPYPAVFLICLAAGCXIC--WF 227 + +LL + + +L +P VF I A GC +C WF Sbjct: 181 FIVLLVTGIICESLGWPMVFYIFGACGCAVCLLWF 215
>LX15B_MOUSE (O35936) Arachidonate 15-lipoxygenase type II (EC 1.13.11.33)| (15-LOX-2) (8S-lipoxygenase) (8S-LOX) Length = 677 Score = 29.3 bits (64), Expect = 2.5 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 7/47 (14%) Frame = +2 Query: 197 PGSRVQX-------LLVQHGLLRGLHTQLLRSQPPPGPLPFHKLQRA 316 PG+ +Q LV HG+L G+HT +L +P P L ++ Sbjct: 275 PGTSLQAELEKGSLFLVDHGILSGVHTNILNGKPQFSAAPMTLLHQS 321
>EXON_EBV (P03217) Alkaline exonuclease (EC 3.1.11.-)| Length = 470 Score = 28.1 bits (61), Expect = 5.7 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 226 STRSASWSAYAASPQSTAPW 285 ST + SW AYA + TAPW Sbjct: 438 STAAGSWKAYADNTFDTAPW 457
>MYPR_ONCMY (P79826) Myelin proteolipid protein (PLP) (Lipophilin) (DM20)| Length = 258 Score = 27.3 bits (59), Expect = 9.7 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = +3 Query: 189 LICLAAGCXICWFNTVCFVVCIRSFSAVNRPLALSLSISFNGLS 320 L+C A GC C CIR AV P +S + F G++ Sbjct: 8 LLCKALGCYDC---------CIRCLGAVPYPSLVSTLLCFTGMA 42 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.121 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,271,636 Number of Sequences: 219361 Number of extensions: 425098 Number of successful extensions: 1898 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1827 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1888 length of database: 80,573,946 effective HSP length: 88 effective length of database: 61,270,178 effective search space used: 1470484272 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)