| Clone Name | baal24k09 |
|---|---|
| Clone Library Name | barley_pub |
>SUC3_ARATH (O80605) Sucrose transport protein SUC3 (Sucrose permease 3)| (Sucrose-proton symporter 3) (Sucrose transporter 2) Length = 594 Score = 104 bits (260), Expect = 6e-23 Identities = 46/52 (88%), Positives = 48/52 (92%) Frame = +3 Query: 3 GVQFGWALQLSLLTPYIQTLGIDHAMASFIWLCGPITGFVVQPXVGVWSDKC 158 GVQFGWALQLSLLTPYIQTLGI HA +SFIWLCGPITG VVQP VG+WSDKC Sbjct: 72 GVQFGWALQLSLLTPYIQTLGISHAFSSFIWLCGPITGLVVQPFVGIWSDKC 123
>SUT_SPIOL (Q03411) Sucrose transport protein (Sucrose permease)| (Sucrose-proton symporter) Length = 525 Score = 90.5 bits (223), Expect = 1e-18 Identities = 38/52 (73%), Positives = 45/52 (86%) Frame = +3 Query: 3 GVQFGWALQLSLLTPYIQTLGIDHAMASFIWLCGPITGFVVQPXVGVWSDKC 158 GVQFGWALQLSLLTPY+Q LGI H A++IWLCGPI+G +VQP VG +SD+C Sbjct: 47 GVQFGWALQLSLLTPYVQLLGIPHTWAAYIWLCGPISGMIVQPLVGYYSDRC 98
>SUC9_ARATH (Q9FG00) Sucrose transport protein SUC9 (Sucrose permease 9)| (Sucrose-proton symporter 9) Length = 491 Score = 89.7 bits (221), Expect = 2e-18 Identities = 37/52 (71%), Positives = 45/52 (86%) Frame = +3 Query: 3 GVQFGWALQLSLLTPYIQTLGIDHAMASFIWLCGPITGFVVQPXVGVWSDKC 158 G+QFGWALQLSLLTPY+Q LG+ H +SFIWLCGPI+G +VQP VG +SD+C Sbjct: 42 GIQFGWALQLSLLTPYVQLLGVPHKWSSFIWLCGPISGLLVQPTVGYFSDRC 93
>SUC8_ARATH (Q9ZVK6) Sucrose transport protein SUC8 (Sucrose permease 8)| (Sucrose-proton symporter 8) Length = 492 Score = 89.4 bits (220), Expect = 3e-18 Identities = 36/52 (69%), Positives = 45/52 (86%) Frame = +3 Query: 3 GVQFGWALQLSLLTPYIQTLGIDHAMASFIWLCGPITGFVVQPXVGVWSDKC 158 G+QFGWALQLSLLTPY+Q LG+ H +SFIWLCGP++G +VQP VG +SD+C Sbjct: 42 GIQFGWALQLSLLTPYVQLLGVPHKWSSFIWLCGPVSGLLVQPSVGYFSDRC 93
>SUC6_ARATH (Q6A329) Probable sucrose transport protein SUC6 (Sucrose permease| 6) (Sucrose-proton symporter 6) Length = 492 Score = 89.4 bits (220), Expect = 3e-18 Identities = 36/52 (69%), Positives = 45/52 (86%) Frame = +3 Query: 3 GVQFGWALQLSLLTPYIQTLGIDHAMASFIWLCGPITGFVVQPXVGVWSDKC 158 G+QFGWALQLSLLTPY+Q LG+ H +SFIWLCGP++G +VQP VG +SD+C Sbjct: 42 GIQFGWALQLSLLTPYVQLLGVPHKWSSFIWLCGPVSGLLVQPSVGYFSDRC 93
>SUC7_ARATH (Q67YF8) Probable sucrose transport protein SUC7 (Sucrose permease| 7) (Sucrose-proton symporter 7) Length = 491 Score = 88.6 bits (218), Expect = 4e-18 Identities = 36/52 (69%), Positives = 44/52 (84%) Frame = +3 Query: 3 GVQFGWALQLSLLTPYIQTLGIDHAMASFIWLCGPITGFVVQPXVGVWSDKC 158 G+QFGWALQLSLLTPY+Q LG+ H SFIWLCGP++G +VQP VG +SD+C Sbjct: 41 GIQFGWALQLSLLTPYVQLLGVPHKWPSFIWLCGPVSGLLVQPSVGYFSDRC 92
>SUC5_ARATH (Q9C8X2) Sucrose transport protein SUC5 (Sucrose permease 5)| (Sucrose-proton symporter 5) Length = 512 Score = 87.8 bits (216), Expect = 7e-18 Identities = 38/52 (73%), Positives = 44/52 (84%) Frame = +3 Query: 3 GVQFGWALQLSLLTPYIQTLGIDHAMASFIWLCGPITGFVVQPXVGVWSDKC 158 GVQFGWALQLSLLTPYIQ LGI H +S++WLCGPI+G +VQP VG SD+C Sbjct: 43 GVQFGWALQLSLLTPYIQLLGIPHKWSSYMWLCGPISGMIVQPIVGYHSDRC 94
>SUC2_ARATH (Q39231) Sucrose transport protein SUC2 (Sucrose permease 2)| (Sucrose-proton symporter 2) (Sucrose transporter 1) Length = 512 Score = 87.8 bits (216), Expect = 7e-18 Identities = 39/52 (75%), Positives = 43/52 (82%) Frame = +3 Query: 3 GVQFGWALQLSLLTPYIQTLGIDHAMASFIWLCGPITGFVVQPXVGVWSDKC 158 GVQFGWALQLSLLTPY+Q LGI H AS IWLCGPI+G +VQP VG SD+C Sbjct: 41 GVQFGWALQLSLLTPYVQLLGIPHKWASLIWLCGPISGMLVQPIVGYHSDRC 92
>SUC1_ARATH (Q39232) Sucrose transport protein SUC1 (Sucrose permease 1)| (Sucrose-proton symporter 1) Length = 513 Score = 87.0 bits (214), Expect = 1e-17 Identities = 37/52 (71%), Positives = 43/52 (82%) Frame = +3 Query: 3 GVQFGWALQLSLLTPYIQTLGIDHAMASFIWLCGPITGFVVQPXVGVWSDKC 158 GVQFGWALQLSLLTPY+Q LGI H +S IWLCGP++G +VQP VG SD+C Sbjct: 42 GVQFGWALQLSLLTPYVQLLGIPHKWSSLIWLCGPVSGMIVQPIVGFHSDRC 93
>SUC4_ARATH (Q9FE59) Sucrose transport protein SUC4 (Sucrose permease 4)| (Sucrose-proton symporter 4) (Sucrose transporter 4) Length = 510 Score = 86.3 bits (212), Expect = 2e-17 Identities = 38/52 (73%), Positives = 43/52 (82%) Frame = +3 Query: 3 GVQFGWALQLSLLTPYIQTLGIDHAMASFIWLCGPITGFVVQPXVGVWSDKC 158 G+QFGWALQLSLLTPY+Q LGI HA AS IWLCGP++G VQP VG SD+C Sbjct: 52 GIQFGWALQLSLLTPYVQELGIPHAWASVIWLCGPLSGLFVQPLVGHSSDRC 103
>S45A1_RAT (Q8K4S3) Proton-associated sugar transporter A (PAST-A) (Solute| carrier family 45 member 1) Length = 751 Score = 56.6 bits (135), Expect = 2e-08 Identities = 19/52 (36%), Positives = 35/52 (67%) Frame = +3 Query: 3 GVQFGWALQLSLLTPYIQTLGIDHAMASFIWLCGPITGFVVQPXVGVWSDKC 158 G++F +A++ + +TP + +G+ + S +W PI GF++QP +G WSD+C Sbjct: 96 GIEFSYAMETAYVTPVLLQMGLPDQLYSLVWFISPILGFLLQPLLGAWSDRC 147
>S45A1_MOUSE (Q8BIV7) Proton-associated sugar transporter A (PAST-A) (Solute| carrier family 45 member 1) (Deleted in neuroblastoma 5 protein homolog) (DNb-5 homolog) Length = 751 Score = 56.6 bits (135), Expect = 2e-08 Identities = 19/52 (36%), Positives = 35/52 (67%) Frame = +3 Query: 3 GVQFGWALQLSLLTPYIQTLGIDHAMASFIWLCGPITGFVVQPXVGVWSDKC 158 G++F +A++ + +TP + +G+ + S +W PI GF++QP +G WSD+C Sbjct: 96 GIEFSYAMETAYVTPVLLQMGLPDQLYSLVWFISPILGFLLQPLLGAWSDRC 147
>S45A1_HUMAN (Q9Y2W3) Proton-associated sugar transporter A (PAST-A) (Solute| carrier family 45 member 1) (Deleted in neuroblastoma 5 protein) (DNb-5) Length = 782 Score = 56.6 bits (135), Expect = 2e-08 Identities = 19/52 (36%), Positives = 35/52 (67%) Frame = +3 Query: 3 GVQFGWALQLSLLTPYIQTLGIDHAMASFIWLCGPITGFVVQPXVGVWSDKC 158 G++F +A++ + +TP + +G+ + S +W PI GF++QP +G WSD+C Sbjct: 130 GIEFSYAMETAYVTPVLLQMGLPDQLYSLVWFISPILGFLLQPLLGAWSDRC 181
>SUT1_SCHPO (O14091) General alpha-glucoside permease| Length = 553 Score = 56.2 bits (134), Expect = 2e-08 Identities = 22/51 (43%), Positives = 34/51 (66%) Frame = +3 Query: 3 GVQFGWALQLSLLTPYIQTLGIDHAMASFIWLCGPITGFVVQPXVGVWSDK 155 GVQ W+++L TPY+ +LG+ S IW+ GP+TG ++QP G+ SD+ Sbjct: 45 GVQLTWSVELGYGTPYLFSLGLRKEWTSIIWIAGPLTGILIQPIAGILSDR 95
>S45A2_MOUSE (P58355) Membrane-associated transporter protein (AIM-1 protein)| (Melanoma antigen AIM1) (Solute carrier family 45 member 2) (Underwhite protein) Length = 530 Score = 49.3 bits (116), Expect = 3e-06 Identities = 20/52 (38%), Positives = 35/52 (67%) Frame = +3 Query: 3 GVQFGWALQLSLLTPYIQTLGIDHAMASFIWLCGPITGFVVQPXVGVWSDKC 158 G +F +A++ + +TP + ++G+ ++ S +WL PI GF++QP VG SD C Sbjct: 44 GREFCYAVEAAYVTPVLLSVGLPKSLYSMVWLLSPILGFLLQPVVGSASDHC 95
>S45A2_HUMAN (Q9UMX9) Membrane-associated transporter protein (AIM-1 protein)| (Melanoma antigen AIM1) (Solute carrier family 45 member 2) Length = 530 Score = 47.8 bits (112), Expect = 8e-06 Identities = 19/52 (36%), Positives = 34/52 (65%) Frame = +3 Query: 3 GVQFGWALQLSLLTPYIQTLGIDHAMASFIWLCGPITGFVVQPXVGVWSDKC 158 G +F +A++ + +TP + ++G+ ++ S +W PI GF++QP VG SD C Sbjct: 44 GREFCYAVEAAYVTPVLLSVGLPSSLYSIVWFLSPILGFLLQPVVGSASDHC 95
>PANE_PYRAE (Q8ZT70) Putative 2-dehydropantoate 2-reductase (EC 1.1.1.169)| (Ketopantoate reductase) (KPA reductase) (KPR) Length = 279 Score = 30.4 bits (67), Expect = 1.4 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -2 Query: 109 IGPQSQMKDAMAWSIPRVWMYGVRRESCSAQ 17 IG ++K+A S+P V YGV RE C A+ Sbjct: 88 IGGYEEIKEAYPNSVPAVVTYGVYREGCRAE 118
>FAD3C_RICCO (P48619) Omega-3 fatty acid desaturase, chloroplast precursor (EC| 1.14.19.-) Length = 460 Score = 29.6 bits (65), Expect = 2.4 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 101 WAYYWFCRSTLXWSL 145 W YWFC+ T+ W+L Sbjct: 158 WPLYWFCQGTMFWAL 172
>YM11_PARTE (P15612) Hypothetical 43.7 kDa protein (ORF11)| Length = 367 Score = 29.3 bits (64), Expect = 3.1 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 83 VLHLALWAYYWFCRSTLXWSL 145 V+H+A W Y+W+ T WSL Sbjct: 23 VIHIAQWQYWWWFWFTYLWSL 43
>FAD3C_SESIN (P48620) Omega-3 fatty acid desaturase, chloroplast precursor (EC| 1.14.19.-) Length = 447 Score = 28.1 bits (61), Expect = 6.9 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +2 Query: 98 LWAYYWFCRSTLXWSL 145 +W YWF +ST+ W+L Sbjct: 147 VWPLYWFAQSTMFWAL 162
>FAD3D_ARATH (P48622) Temperature-sensitive omega-3 fatty acid desaturase,| chloroplast precursor (EC 1.14.19.-) Length = 435 Score = 27.7 bits (60), Expect = 9.0 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 98 LWAYYWFCRSTLXWSL 145 LW YWF + T+ W+L Sbjct: 136 LWPLYWFAQGTMFWAL 151 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,549,028 Number of Sequences: 219361 Number of extensions: 353812 Number of successful extensions: 1064 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 1056 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1064 length of database: 80,573,946 effective HSP length: 28 effective length of database: 74,431,838 effective search space used: 1786364112 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)