ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baal23p24 |
|---|---|
| Clone Library Name | barley_pub |
>TIP12_ORYSA (Q94CS9) Probable aquaporin TIP1.2 (Tonoplast intrinsic protein| 1.2) (OsTIP1.2) Length = 252 Score = 47.4 bits (111), Expect = 1e-05 Identities = 23/26 (88%), Positives = 23/26 (88%) Frame = -2 Query: 170 EFISMLIXVFAGSGSGMAFGKLTDXG 93 EFISMLI VFAGSGSGMAF KLTD G Sbjct: 26 EFISMLIFVFAGSGSGMAFSKLTDGG 51 Score = 46.6 bits (109), Expect = 2e-05 Identities = 20/26 (76%), Positives = 24/26 (92%) Frame = +3 Query: 30 MPVSRIAIGAPGELSHPDTFRAXVSQ 107 MPVSRIA+GAPGELSHPDT +A V++ Sbjct: 1 MPVSRIAVGAPGELSHPDTAKAAVAE 26
>TIP12_ARATH (Q41963) Aquaporin TIP1.2 (Tonoplast intrinsic protein 1.2)| (Gamma-tonoplast intrinsic protein 2) (Gamma-TIP2) (Salt stress-induced tonoplast intrinsic protein) Length = 253 Score = 44.3 bits (103), Expect = 9e-05 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = -2 Query: 170 EFISMLIXVFAGSGSGMAFGKLTDXGA 90 EFIS LI VFAGSGSG+AF K+TD GA Sbjct: 27 EFISTLIFVFAGSGSGIAFNKITDNGA 53
>TIP11_ORYSA (P50156) Probable aquaporin TIP1.1 (Tonoplast intrinsic protein| 1.1) (OsTIP1.1) (rTIP1) Length = 250 Score = 42.4 bits (98), Expect = 3e-04 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = -2 Query: 170 EFISMLIXVFAGSGSGMAFGKLTDXGA 90 EFIS LI VFAG GSGMAF KLT GA Sbjct: 26 EFISTLIFVFAGQGSGMAFSKLTGGGA 52
>TIP11_ARATH (P25818) Aquaporin TIP1.1 (Tonoplast intrinsic protein 1.1)| (Gamma-tonoplast intrinsic protein) (Gamma-TIP) (Aquaporin-TIP) (Tonoplast intrinsic protein, root-specific RB7) Length = 251 Score = 42.4 bits (98), Expect = 3e-04 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -2 Query: 170 EFISMLIXVFAGSGSGMAFGKLTDXGA 90 EFIS LI V AGSGSGMAF KLT+ GA Sbjct: 26 EFISTLIFVVAGSGSGMAFNKLTENGA 52 Score = 29.6 bits (65), Expect = 2.3 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 30 MPVSRIAIGAPGELSHPDTFRAXVSQ 107 MP+ IAIG P E + PD +A +++ Sbjct: 1 MPIRNIAIGRPDEATRPDALKAALAE 26
>TIP13_ARATH (O82598) Putative aquaporin TIP1.3 (Tonoplast intrinsic protein| 1.3) (Gamma-tonoplast intrinsic protein 3) (Gamma-TIP3) Length = 252 Score = 41.6 bits (96), Expect = 6e-04 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = -2 Query: 170 EFISMLIXVFAGSGSGMAFGKLTDXG 93 EF SM+I VFAG GSGMA+GKLT G Sbjct: 26 EFFSMVIFVFAGQGSGMAYGKLTGDG 51 Score = 37.0 bits (84), Expect = 0.015 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = +3 Query: 30 MPVSRIAIGAPGELSHPDTFRAXVSQ 107 MP++RIAIG PGE S PD RA ++ Sbjct: 1 MPINRIAIGTPGEASRPDAIRAAFAE 26
>TIP1_MEDTR (Q9FY14) Probable aquaporin TIP-type (MtAQP1)| Length = 250 Score = 40.4 bits (93), Expect = 0.001 Identities = 19/27 (70%), Positives = 22/27 (81%) Frame = -2 Query: 170 EFISMLIXVFAGSGSGMAFGKLTDXGA 90 EFIS I VFAGSGSG+A+ KLT+ GA Sbjct: 26 EFISTFIFVFAGSGSGIAYNKLTNDGA 52 Score = 33.9 bits (76), Expect = 0.12 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +3 Query: 30 MPVSRIAIGAPGELSHPDTFRAXVSQ 107 MP+ IA+G P E +HPDT +A +++ Sbjct: 1 MPIRNIAVGTPQEATHPDTLKAGLAE 26
>TIP1_MEDSA (P42067) Probable aquaporin TIP-type (Membrane channel protein 1)| (MsMCP1) Length = 249 Score = 40.4 bits (93), Expect = 0.001 Identities = 19/27 (70%), Positives = 22/27 (81%) Frame = -2 Query: 170 EFISMLIXVFAGSGSGMAFGKLTDXGA 90 EFIS I VFAGSGSG+A+ KLT+ GA Sbjct: 26 EFISTFIFVFAGSGSGIAYNKLTNDGA 52 Score = 33.9 bits (76), Expect = 0.12 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +3 Query: 30 MPVSRIAIGAPGELSHPDTFRAXVSQ 107 MP+ IA+G P E +HPDT +A +++ Sbjct: 1 MPIRNIAVGTPQEATHPDTLKAGLAE 26
>TIP23_ARATH (Q9FGL2) Probable aquaporin TIP2.3 (Tonoplast intrinsic protein| 2.3) Length = 250 Score = 36.2 bits (82), Expect = 0.025 Identities = 17/27 (62%), Positives = 20/27 (74%) Frame = -2 Query: 170 EFISMLIXVFAGSGSGMAFGKLTDXGA 90 EFI+ L+ VFAG GS +AF KLT GA Sbjct: 24 EFIATLLFVFAGVGSAVAFAKLTSDGA 50
>TIP21_ORYSA (Q7XA61) Probable aquaporin TIP2.1 (Tonoplast intrinsic protein| 2.1) (OsTIP2.1) Length = 248 Score = 36.2 bits (82), Expect = 0.025 Identities = 16/27 (59%), Positives = 22/27 (81%) Frame = -2 Query: 170 EFISMLIXVFAGSGSGMAFGKLTDXGA 90 EFI+ L+ VFAG GS +A+G+LT+ GA Sbjct: 24 EFIATLLFVFAGVGSAIAYGQLTNGGA 50
>TIP22_ARATH (Q41975) Probable aquaporin TIP2.2 (Tonoplast intrinsic protein| 2.2) Length = 250 Score = 34.3 bits (77), Expect = 0.095 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = -2 Query: 170 EFISMLIXVFAGSGSGMAFGKLTDXGA 90 EFI+ L+ VFAG GS +AF KLT A Sbjct: 24 EFIATLLFVFAGVGSALAFAKLTSDAA 50
>TIP21_ARATH (Q41951) Aquaporin TIP2.1 (Tonoplast intrinsic protein 2.1)| (Delta-tonoplast intrinsic protein) (Delta-TIP) Length = 250 Score = 33.9 bits (76), Expect = 0.12 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = -2 Query: 170 EFISMLIXVFAGSGSGMAFGKLTDXGA 90 EFIS L+ VFAG GS +A+ KLT A Sbjct: 24 EFISTLLFVFAGVGSAIAYAKLTSDAA 50
>LTBP4_MOUSE (Q8K4G1) Latent transforming growth factor beta-binding protein 4| precursor (LTBP-4) Length = 1666 Score = 33.5 bits (75), Expect = 0.16 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +1 Query: 49 PSAPRGSCPTRTPSAPXSVSLPKAMPEPEPAK 144 P AP G+ P P AP S SLP P P P + Sbjct: 1177 PRAPAGTFPGSQPQAPASPSLPARPPAPPPPR 1208
>TIP_ANTMA (P33560) Probable aquaporin TIP-type (Tonoplast intrinsic protein| DiP) (Dark intrinsic protein) Length = 250 Score = 32.7 bits (73), Expect = 0.28 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = -2 Query: 170 EFISMLIXVFAGSGSGMAFGKLTDXGA 90 EFI+ L+ VFAG GS +A+ KLT A Sbjct: 24 EFIATLLFVFAGVGSAIAYNKLTSDAA 50
>TIP22_ORYSA (Q5Z6F0) Probable aquaporin TIP2.2 (Tonoplast intrinsic protein| 2.2) (OsTIP2.2) Length = 248 Score = 32.3 bits (72), Expect = 0.36 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = -2 Query: 170 EFISMLIXVFAGSGSGMAFGKLT 102 EFIS L+ VFAG GS +A+ KLT Sbjct: 25 EFISTLVFVFAGVGSAIAYTKLT 47
>TIP2_TOBAC (P24422) Probable aquaporin TIP-type RB7-18C (Tonoplast intrinsic| protein, root-specific RB7-18C) (TobRB7) (RT-TIP) Length = 250 Score = 32.0 bits (71), Expect = 0.47 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = -2 Query: 170 EFISMLIXVFAGSGSGMAFGKLTDXGA 90 EFI+ L+ VFAG GS +A+ KLT A Sbjct: 24 EFIATLLFVFAGVGSAIAYNKLTADAA 50
>TIP1_TOBAC (P21653) Probable aquaporin TIP-type RB7-5A (Tonoplast intrinsic| protein, root-specific RB7-5A) (TobRB7) (RT-TIP) Length = 250 Score = 32.0 bits (71), Expect = 0.47 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = -2 Query: 170 EFISMLIXVFAGSGSGMAFGKLTDXGA 90 EFI+ L+ VFAG GS +A+ KLT A Sbjct: 24 EFIATLLFVFAGVGSAIAYNKLTADAA 50
>IF2_CORDI (Q6NGN2) Translation initiation factor IF-2| Length = 953 Score = 30.0 bits (66), Expect = 1.8 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +1 Query: 40 AGSPSAPRGSCPTRTPSAPXSVSLPKAMPEPEP 138 A P+AP+ + + T + P S+ P+A P P+P Sbjct: 136 APKPAAPKPAAQSSTTATPGSMPRPQAKPAPKP 168
>GT5_ARATH (Q9CA75) Putative glycosyltransferase 5 (EC 2.4.-.-) (AtGT5)| Length = 457 Score = 29.6 bits (65), Expect = 2.3 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = -2 Query: 140 AGSGSGMAFGKLTDXGAEGVRVGQLPRG 57 +GSG G+ LT+ G G R G LPRG Sbjct: 13 SGSGGGLPTTTLTNGGGRGGRGGLLPRG 40
>PRG4_HUMAN (Q92954) Proteoglycan-4 precursor (Lubricin) (Megakaryocyte| stimulating factor) (Superficial zone proteoglycan) [Contains: Proteoglycan-4 C-terminal part] Length = 1404 Score = 29.6 bits (65), Expect = 2.3 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 10 KKSARRKCR*AGSPSA-PRGSCPTRTPSAPXSVSLPKAMPEPEPAKT 147 +++A+ K R S + P+ PT+ P P S PK MP KT Sbjct: 1002 EETAKPKDRATNSKATTPKPQKPTKAPKKPTSTKKPKTMPRVRKPKT 1048 Score = 28.9 bits (63), Expect = 4.0 Identities = 16/44 (36%), Positives = 19/44 (43%), Gaps = 9/44 (20%) Frame = +1 Query: 46 SPSAPRGSCPTRTPSAPXSV---------SLPKAMPEPEPAKTK 150 SP+ P+ PT T SAP + S P EP P TK Sbjct: 515 SPTTPKEPAPTTTKSAPTTTKEPAPTTTKSAPTTPKEPSPTTTK 558 Score = 28.5 bits (62), Expect = 5.2 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 Query: 46 SPSAPRGSCPTRTPSAPXSVSLPKAMPEPEPAKT 147 +P+ P+ PT T SAP + P EPA T Sbjct: 374 APTTPKEPAPTTTKSAPTTPKEPAPTTTKEPAPT 407
>GUN1_ACICE (P54583) Endoglucanase E1 precursor (EC 3.2.1.4)| (Endo-1,4-beta-glucanase E1) (Cellulase E1) (Endocellulase E1) Length = 562 Score = 29.3 bits (64), Expect = 3.0 Identities = 20/54 (37%), Positives = 24/54 (44%), Gaps = 12/54 (22%) Frame = +1 Query: 46 SPSAPRGSCPTRTPSA-------PXSVSLPKAMPEPEP-----AKTKMSMDMNS 171 SPSA R PT TP+A P + P A P P P A+ S +NS Sbjct: 420 SPSASRTPTPTPTPTASPTPTLTPTATPTPTASPTPSPTAASGARCTASYQVNS 473
>HPH1_YEAST (Q99332) Protein HPH1 (High pH protein 1) (Functionally related to| TCP1 protein 1) Length = 602 Score = 29.3 bits (64), Expect = 3.0 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 6/42 (14%) Frame = +1 Query: 49 PSAPRGSCPTRTPSAPXSVSL------PKAMPEPEPAKTKMS 156 PS PRG C R S+ +V + P+ PEP AKT ++ Sbjct: 21 PSFPRGFCKGRRASSGDAVKIKESGLQPQPQPEPLQAKTNVA 62
>TIPA_PHAVU (P23958) Probable aquaporin TIP-type alpha (Tonoplast intrinsic| protein alpha) (Alpha TIP) Length = 256 Score = 28.9 bits (63), Expect = 4.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 170 EFISMLIXVFAGSGSGMAFGKLTDXGA 90 EF S I VFAG GSG+A K+ A Sbjct: 26 EFASTFIFVFAGEGSGLALVKIYQDSA 52
>TMM28_HUMAN (O75949) Transmembrane protein 28 (TED protein)| Length = 473 Score = 28.5 bits (62), Expect = 5.2 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 4/36 (11%) Frame = +1 Query: 43 GSPSAPRGSCPTR----TPSAPXSVSLPKAMPEPEP 138 G PSAP G+C R T +AP + S P PEP Sbjct: 105 GEPSAPPGTCGPRYSNLTKAAPAAGSRPVCGGVPEP 140
>AMOT_HUMAN (Q4VCS5) Angiomotin| Length = 1084 Score = 28.1 bits (61), Expect = 6.8 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +1 Query: 40 AGSPSAPRGSCPTRTPSAPXSVSLPKAMPEPEPAKTKMS 156 A +PSA + P+AP V P +P P PA + S Sbjct: 958 AVAPSAAAAAAVQVAPAAPAPVPAPALVPVPAPAAAQAS 996
>KCO1_ARATH (Q8LBL1) Calcium-activated outward-rectifying potassium channel 1| (AtKCO1) Length = 363 Score = 28.1 bits (61), Expect = 6.8 Identities = 19/56 (33%), Positives = 26/56 (46%) Frame = +1 Query: 1 IQGKKSARRKCR*AGSPSAPRGSCPTRTPSAPXSVSLPKAMPEPEPAKTKMSMDMN 168 + + S+ RK R S SAPRG C V + + P P P+K M D+N Sbjct: 25 LNSRTSSSRKRRLRRSRSAPRGDCMYN-----DDVKIDE--PPPHPSKIPMFSDLN 73
>AMPH_RAT (O08838) Amphiphysin| Length = 683 Score = 28.1 bits (61), Expect = 6.8 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 4/54 (7%) Frame = +1 Query: 1 IQGKKSARRKCR*AGSPSAPRGSCPTRTPSAPXSVSLPKAMPEP----EPAKTK 150 IQG S R A +PS P + P +P+A + +L A P P P++T+ Sbjct: 245 IQGAPSDSGPLRIAKTPSPPEEASPLPSPTASPNHTLAPASPAPVRPRSPSQTR 298
>ZIPA_SALTY (P0A2N6) Cell division protein zipA homolog| Length = 328 Score = 27.7 bits (60), Expect = 8.9 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +1 Query: 49 PSAPRGSCPTRTPSAPXSVSLPKAMPEPEPA 141 PSAP P + P+ P P A P P P+ Sbjct: 132 PSAPPVQPPQQQPAPPSQAPQPVAQPAPPPS 162
>ZIPA_SALTI (P0A2N7) Cell division protein zipA homolog| Length = 328 Score = 27.7 bits (60), Expect = 8.9 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +1 Query: 49 PSAPRGSCPTRTPSAPXSVSLPKAMPEPEPA 141 PSAP P + P+ P P A P P P+ Sbjct: 132 PSAPPVQPPQQQPAPPSQAPQPVAQPAPPPS 162
>VEGFB_HUMAN (P49765) Vascular endothelial growth factor B precursor (VEGF-B)| (VEGF-related factor) (VRF) Length = 207 Score = 27.7 bits (60), Expect = 8.9 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -3 Query: 91 RKVSGWDSSPGAP 53 R V GWDS+PGAP Sbjct: 148 RSVPGWDSAPGAP 160
>TEGU_HHV11 (P10220) Large tegument protein (Virion protein UL36)| Length = 3164 Score = 27.7 bits (60), Expect = 8.9 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +1 Query: 55 APRGSCPTRTPSA-PXSVSLPKAMPEPEPAKTK 150 A +G+ PT PSA P S P A+P P P+ K Sbjct: 359 ALKGTPPTDPPSADPPSADPPSAIPPPPPSAPK 391
>LSM11_MOUSE (Q8BUV6) U7 snRNA-associated Sm-like protein LSm11| Length = 361 Score = 27.7 bits (60), Expect = 8.9 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = +1 Query: 1 IQGKKSARRKCR*AGSPSAPRGSCPTRTPSAPXSVSLPKAMPEPEPAK 144 ++G ++ R + R G P++ S T T + S + +A P P+P + Sbjct: 63 LKGGRTGRGRARGTGEPASAGTSTGTSTGAGSSSRARRRAAPTPDPER 110 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,171,883 Number of Sequences: 219361 Number of extensions: 357757 Number of successful extensions: 2594 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 2273 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2585 length of database: 80,573,946 effective HSP length: 32 effective length of database: 73,554,394 effective search space used: 1765305456 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
