| Clone Name | baal23n13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RA6I1_MOUSE (Q6PAL8) Rab6-interacting protein 1 (Rab6IP1) | 31 | 1.0 | 2 | RA6I1_HUMAN (Q6IQ26) Rab6-interacting protein 1 (Rab6IP1) | 31 | 1.0 | 3 | ZCHC7_HUMAN (Q8N3Z6) Zinc finger CCHC domain-containing protein 7 | 29 | 3.0 |
|---|
>RA6I1_MOUSE (Q6PAL8) Rab6-interacting protein 1 (Rab6IP1)| Length = 1287 Score = 30.8 bits (68), Expect = 1.0 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -2 Query: 98 WLCLDGCLGESQLVCRPQLITEEAXLCRALG 6 W+C+ G LGE+Q++ P+ + E C+ LG Sbjct: 976 WICISGELGETQILQIPRNVLEMTFECQNLG 1006
>RA6I1_HUMAN (Q6IQ26) Rab6-interacting protein 1 (Rab6IP1)| Length = 1287 Score = 30.8 bits (68), Expect = 1.0 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -2 Query: 98 WLCLDGCLGESQLVCRPQLITEEAXLCRALG 6 W+C+ G LGE+Q++ P+ + E C+ LG Sbjct: 976 WICISGELGETQIMQIPRNVLEMTFECQNLG 1006
>ZCHC7_HUMAN (Q8N3Z6) Zinc finger CCHC domain-containing protein 7| Length = 542 Score = 29.3 bits (64), Expect = 3.0 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +2 Query: 86 PSKARLCILCSKQGWW*Y*CEAPAQE 163 P K R C LCS++G Y C AP E Sbjct: 258 PRKVRRCFLCSRRGHLLYSCPAPLCE 283 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,079,414 Number of Sequences: 219361 Number of extensions: 570477 Number of successful extensions: 1780 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1744 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1778 length of database: 80,573,946 effective HSP length: 37 effective length of database: 72,457,589 effective search space used: 1738982136 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)