| Clone Name | baal23n08 |
|---|---|
| Clone Library Name | barley_pub |
>CRD1_HORVU (Q5EFU4) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) (Protein Xantha-l) Length = 417 Score = 92.4 bits (228), Expect = 3e-19 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +2 Query: 8 HDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 148 +DLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY Sbjct: 371 NDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 417
>CRD1_GOSHI (Q6SJV8) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 405 Score = 82.4 bits (202), Expect = 3e-16 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = +2 Query: 11 DLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 148 D+PLVKNLKR+PLIA L SE++A YLMPPIESGSVDFAEFEP+LVY Sbjct: 360 DIPLVKNLKRIPLIAALASELLATYLMPPIESGSVDFAEFEPQLVY 405
>CRD1_EUPES (Q945B7) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 405 Score = 82.0 bits (201), Expect = 4e-16 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = +2 Query: 11 DLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 148 D +VKNLKRVPLIA LVSEI+AAYLMPPIESGSVDFAEFEPKLVY Sbjct: 360 DNSVVKNLKRVPLIAALVSEILAAYLMPPIESGSVDFAEFEPKLVY 405
>CRD1_ARATH (Q9M591) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) (Copper response defect 1 protein) (Dicarboxylate diiron protein) (AtZIP Length = 409 Score = 73.9 bits (180), Expect = 1e-13 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = +2 Query: 11 DLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 148 D +K LKR+PL+ L SEI+AAYLMPP+ESGSVDFAEFEP LVY Sbjct: 364 DASFIKTLKRIPLVTSLASEILAAYLMPPVESGSVDFAEFEPNLVY 409
>CTH1_CHLRE (Q9AR22) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase 2, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase 2) (Copper target homolog 1 protein) Length = 407 Score = 35.0 bits (79), Expect = 0.053 Identities = 14/42 (33%), Positives = 26/42 (61%) Frame = +2 Query: 23 VKNLKRVPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 148 +K + + P++ ++V+E+ ++M P ESGS D + LVY Sbjct: 366 IKAIMKAPILERMVAEVFQVFIMTPKESGSYDLDANKTALVY 407
>ACSF_PORPU (P51277) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 349 Score = 31.6 bits (70), Expect = 0.58 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +2 Query: 17 PLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSV 115 PLVK + PL L+ +I YL+ PI+S +V Sbjct: 312 PLVKTFMKAPLYMSLILNLIKIYLIKPIDSQAV 344
>ACSF1_ANASP (Q8YX57) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase 1 (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase 1) Length = 351 Score = 28.5 bits (62), Expect = 4.9 Identities = 11/28 (39%), Positives = 21/28 (75%) Frame = +2 Query: 23 VKNLKRVPLIAQLVSEIIAAYLMPPIES 106 VK ++++PLIA +V ++ YL+ PI++ Sbjct: 316 VKLIRKLPLIAAIVWNLLMVYLIKPIDT 343
>GRIPE_HUMAN (Q6GYQ0) GTPase-activating Rap/Ran-GAP domain-like 1| (GAP-related-interacting partner to E12) (GRIPE) (Tuberin-like protein 1) Length = 2036 Score = 28.1 bits (61), Expect = 6.4 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -2 Query: 191 FVKIGRDESFFDKFSRQAWAQIRQNQRSQTRLGA*GTQR 75 F K+ D+SF +SR Q QRS T G+ GT++ Sbjct: 707 FQKVSVDKSFSRGWSRDQPGQAPMRQRSATTTGSPGTEK 745
>GRIPE_MOUSE (Q6GYP7) GTPase-activating RapGAP domain-like 1| (GAP-related-interacting partner to E12) (GRIPE) (Tuberin-like protein 1) Length = 2035 Score = 28.1 bits (61), Expect = 6.4 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -2 Query: 191 FVKIGRDESFFDKFSRQAWAQIRQNQRSQTRLGA*GTQR 75 F K+ D+SF +SR Q QRS T G+ GT++ Sbjct: 706 FQKVSVDKSFSRGWSRDQPGQAPMRQRSATTTGSPGTEK 744 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,653,280 Number of Sequences: 219361 Number of extensions: 451350 Number of successful extensions: 1205 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1197 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1205 length of database: 80,573,946 effective HSP length: 50 effective length of database: 69,605,896 effective search space used: 1670541504 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)