| Clone Name | baal24c03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NUD15_ARATH (Q8GYB1) Nudix hydrolase 15, mitochondrial precursor... | 43 | 3e-04 | 2 | NUD22_ARATH (O22951) Nudix hydrolase 22, chloroplast precursor (... | 35 | 0.055 | 3 | CIC_DROME (Q9U1H0) Putative transcription factor capicua (Protei... | 29 | 3.9 | 4 | CLCN2_RAT (P35525) Chloride channel protein 2 (ClC-2) | 28 | 5.1 | 5 | CLCN2_MOUSE (Q9R0A1) Chloride channel protein 2 (ClC-2) | 28 | 5.1 |
|---|
>NUD15_ARATH (Q8GYB1) Nudix hydrolase 15, mitochondrial precursor (EC 3.6.1.-)| (AtNUDT15) Length = 285 Score = 42.7 bits (99), Expect = 3e-04 Identities = 28/76 (36%), Positives = 36/76 (47%), Gaps = 21/76 (27%) Frame = +3 Query: 18 MEALIQRXRLHRPPPSPYAGDPSTAATPN--AGEL-------------------FKPRRA 134 + AL Q+ R ++PPPS D T AG++ FKP+RA Sbjct: 43 LAALAQQLRQYKPPPSSSFDDSEEMQTDQETAGKVVSQVGFQESIAPLSKDPDRFKPKRA 102 Query: 135 XVLICLFRGSAGELRV 182 VLICLF G G+LRV Sbjct: 103 AVLICLFEGDDGDLRV 118
>NUD22_ARATH (O22951) Nudix hydrolase 22, chloroplast precursor (EC 3.6.1.-)| (AtNUDT22) Length = 302 Score = 35.0 bits (79), Expect = 0.055 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = +3 Query: 117 FKPRRAXVLICLFRGSAGELRV 182 F+P++A VLICLF G G+LRV Sbjct: 71 FRPKKAAVLICLFEGDDGDLRV 92
>CIC_DROME (Q9U1H0) Putative transcription factor capicua (Protein fettucine)| Length = 1403 Score = 28.9 bits (63), Expect = 3.9 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +3 Query: 9 PR*MEALIQRXRLHRPPPSPYAGDPSTAATPNAG 110 P + L Q+ H+PPP P A P+ +A P +G Sbjct: 157 PPQQQPLQQQHHHHQPPPPPPASLPAPSAPPTSG 190
>CLCN2_RAT (P35525) Chloride channel protein 2 (ClC-2)| Length = 907 Score = 28.5 bits (62), Expect = 5.1 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = +3 Query: 33 QRXRLHRPPPSPYAGDPSTAATPNAGELFKPRRAXVLICLFR 158 + R+ P P+ G PS ATP E + R A IC R Sbjct: 43 EAARIRLGGPEPWKGSPSARATPELLEYGQSRCARCRICSVR 84
>CLCN2_MOUSE (Q9R0A1) Chloride channel protein 2 (ClC-2)| Length = 908 Score = 28.5 bits (62), Expect = 5.1 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = +3 Query: 33 QRXRLHRPPPSPYAGDPSTAATPNAGELFKPRRAXVLICLFR 158 + R+ P P+ G PS ATP E + R A IC R Sbjct: 45 EAARIRLGGPEPWKGSPSARATPELLEYGQSRCARCRICSVR 86 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,927,432 Number of Sequences: 219361 Number of extensions: 384609 Number of successful extensions: 1580 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1511 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1579 length of database: 80,573,946 effective HSP length: 36 effective length of database: 72,676,950 effective search space used: 1744246800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)