| Clone Name | baal23i08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y1610_METJA (Q59005) Hypothetical glycosyl hydrolase MJ1610 (EC ... | 29 | 2.4 | 2 | MDL1_YEAST (P33310) ATP-dependent permease MDL1, mitochondrial p... | 28 | 5.4 | 3 | ROS1_ARATH (Q9SJQ6) ROS1 protein (Repressor of silencing 1) (DEM... | 28 | 5.4 |
|---|
>Y1610_METJA (Q59005) Hypothetical glycosyl hydrolase MJ1610 (EC 3.2.1.-)| Length = 615 Score = 29.3 bits (64), Expect = 2.4 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = +1 Query: 130 SLYFKRLYLFDRDSDSGETNAHVFKSTSPFRW---YHFHNVFTQ 252 SLY++RLY ++ D + ++ KS F W Y F +F + Sbjct: 537 SLYYRRLYKVLKEKDDNGADIYLQKSKKLFNWVMKYSFDGLFPE 580
>MDL1_YEAST (P33310) ATP-dependent permease MDL1, mitochondrial precursor (ABC| transporter MDL1) (Multidrug resistance-like protein 1) Length = 695 Score = 28.1 bits (61), Expect = 5.4 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 5/53 (9%) Frame = +2 Query: 182 KPTPTSSNRRARSDGI-----IFIMFSHNENDHVPLALLLALFEREQFPAIPS 325 KPT SN ++S G +F++ S E+ ++ LALLL L A+PS Sbjct: 71 KPTLKLSNANSKSSGFKDIKRLFVL-SKPESKYIGLALLLILISSSVSMAVPS 122
>ROS1_ARATH (Q9SJQ6) ROS1 protein (Repressor of silencing 1) (DEMETER-like| protein 1) Length = 1393 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/47 (25%), Positives = 25/47 (53%) Frame = +2 Query: 221 DGIIFIMFSHNENDHVPLALLLALFEREQFPAIPSANSLHXFRSIPS 361 D ++ + + N +DH+ + ++L + P +PS+N S+PS Sbjct: 598 DSVVGVFLTQNVSDHLSSSAFMSLASQFPVPFVPSSNFDAGTSSMPS 644 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,233,381 Number of Sequences: 219361 Number of extensions: 1088983 Number of successful extensions: 2061 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2019 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2061 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)