| Clone Name | baal23i03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | S15A2_RAT (Q63424) Oligopeptide transporter, kidney isoform (Pep... | 32 | 0.73 | 2 | S15A2_MOUSE (Q9ES07) Oligopeptide transporter, kidney isoform (P... | 30 | 4.7 | 3 | NICE1_HUMAN (Q9UGL9) Protein NICE-1 | 30 | 4.7 | 4 | NHS_HUMAN (Q6T4R5) Nance-Horan syndrome protein (Congenital cata... | 29 | 8.1 |
|---|
>S15A2_RAT (Q63424) Oligopeptide transporter, kidney isoform (Peptide| transporter 2) (Kidney H(+)/peptide cotransporter) (Solute carrier family 15 member 2) Length = 729 Score = 32.3 bits (72), Expect = 0.73 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -1 Query: 125 MGPLSSQERRLVYLIPMSTARFLPRP--PPKAGVGRIGGTSIP 3 M P E + P+ST LPRP PPK +I G+S P Sbjct: 1 MNPFQKNESKETLFSPVSTEEMLPRPPSPPKKSPPKIFGSSYP 43
>S15A2_MOUSE (Q9ES07) Oligopeptide transporter, kidney isoform (Peptide| transporter 2) (Kidney H(+)/peptide cotransporter) (Solute carrier family 15 member 2) Length = 729 Score = 29.6 bits (65), Expect = 4.7 Identities = 15/43 (34%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = -1 Query: 125 MGPLSSQERRLVYLIPMSTARFLPRP--PPKAGVGRIGGTSIP 3 M P E + P+ST LP P PPK ++ G+S P Sbjct: 1 MNPFQKNESKETLFSPVSTEEMLPGPPSPPKKSTPKLFGSSYP 43
>NICE1_HUMAN (Q9UGL9) Protein NICE-1| Length = 99 Score = 29.6 bits (65), Expect = 4.7 Identities = 15/28 (53%), Positives = 16/28 (57%), Gaps = 5/28 (17%) Frame = -2 Query: 277 TPAPASASPC-----GCCPWSAACTGSS 209 TPAPAS+S C GCC S C SS Sbjct: 30 TPAPASSSSCCGSGRGCCGDSGCCGSSS 57
>NHS_HUMAN (Q6T4R5) Nance-Horan syndrome protein (Congenital cataracts and| dental anomalies protein) Length = 1630 Score = 28.9 bits (63), Expect = 8.1 Identities = 23/59 (38%), Positives = 28/59 (47%), Gaps = 4/59 (6%) Frame = +3 Query: 96 PPLLRAEGPHQRRQVHAIPPH---RALRLPQRLRPHPH**GEEPVQA-ADQGQHPHGDA 260 PP L+ G +V A P RA+ P L P P P+ A ADQ Q PHG+A Sbjct: 35 PPPLQPPGRRDLDEVEAPGPEEPARAVPAPSGLPPPP-----PPLPAPADQTQPPHGEA 88 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,072,111 Number of Sequences: 219361 Number of extensions: 1086699 Number of successful extensions: 3675 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3525 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3670 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)