| Clone Name | baal22p01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MUSC_HUMAN (O60682) Musculin (Activated B-cell factor 1) (ABF-1) | 29 | 4.0 | 2 | KU86_HUMAN (P13010) ATP-dependent DNA helicase 2 subunit 2 (EC 3... | 28 | 6.8 |
|---|
>MUSC_HUMAN (O60682) Musculin (Activated B-cell factor 1) (ABF-1)| Length = 206 Score = 28.9 bits (63), Expect = 4.0 Identities = 15/52 (28%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +3 Query: 18 GCAGSKDQITLPGKKKCFACKETSHNLDQCRIKDKLGTVARLFGR-STSFPF 170 G AG + LP K CK++ N R + ++ +++ F R TS P+ Sbjct: 85 GSAGGGGKKPLPAKGSAAECKQSQRNAANARERARMRVLSKAFSRLKTSLPW 136
>KU86_HUMAN (P13010) ATP-dependent DNA helicase 2 subunit 2 (EC 3.6.1.-)| (ATP-dependent DNA helicase II 80 kDa subunit) (Lupus Ku autoantigen protein p86) (Ku86) (Ku80) (86 kDa subunit of Ku antigen) (Thyroid-lupus autoantigen) (TLAA) (CTC box-binding fac Length = 731 Score = 28.1 bits (61), Expect = 6.8 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = -3 Query: 145 NSRATVPSLSFILH*SKLCDVSLQAKHFFLP 53 +SR + L I+H K CD+SLQ FFLP Sbjct: 138 SSRFSKSQLDIIIHSLKKCDISLQ---FFLP 165 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,902,954 Number of Sequences: 219361 Number of extensions: 371293 Number of successful extensions: 1485 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1452 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1485 length of database: 80,573,946 effective HSP length: 33 effective length of database: 73,335,033 effective search space used: 1760040792 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)