| Clone Name | baal23e02 |
|---|---|
| Clone Library Name | barley_pub |
>PIP23_ORYSA (Q7XUA6) Probable aquaporin PIP2.3 (Plasma membrane intrinsic| protein 2.3) (OsPIP2.3) Length = 290 Score = 63.5 bits (153), Expect = 1e-10 Identities = 33/40 (82%), Positives = 33/40 (82%), Gaps = 2/40 (5%) Frame = +2 Query: 50 MAKDIEAAPP--GGEYAAKDYSDPPPAPLFDAEELTKXSL 163 MAKDIEAA GGEY AKDYSDPPPAPL DAEELTK SL Sbjct: 1 MAKDIEAAAAAEGGEYMAKDYSDPPPAPLIDAEELTKWSL 40
>PIP22_ORYSA (Q6K215) Probable aquaporin PIP2.2 (Plasma membrane intrinsic| protein 2.2) (OsPIP2.2) Length = 288 Score = 63.5 bits (153), Expect = 1e-10 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = +2 Query: 50 MAKDIEA-APPGGEYAAKDYSDPPPAPLFDAEELTKXSL 163 MAKDIEA AP GGE++AKDY+DPPPAPL D EELTK SL Sbjct: 1 MAKDIEASAPEGGEFSAKDYTDPPPAPLIDVEELTKWSL 39
>PIP21_ORYSA (Q8H5N9) Probable aquaporin PIP2.1 (Plasma membrane intrinsic| protein 2a) (PIP2a) (OsPIP2.1) Length = 290 Score = 47.8 bits (112), Expect = 8e-06 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 2/40 (5%) Frame = +2 Query: 50 MAKD--IEAAPPGGEYAAKDYSDPPPAPLFDAEELTKXSL 163 M KD +E+ GE+AAKDY+DPPPAPL DA EL SL Sbjct: 1 MGKDEVMESGGAAGEFAAKDYTDPPPAPLIDAAELGSWSL 40
>PIP23_ARATH (P30302) Aquaporin PIP2.3 (Plasma membrane intrinsic protein 2c)| (PIP2c) (TMP2C) (RD28-PIP) (Water stress-induced tonoplast intrinsic protein) (WSI-TIP) Length = 285 Score = 47.8 bits (112), Expect = 8e-06 Identities = 24/38 (63%), Positives = 27/38 (71%) Frame = +2 Query: 50 MAKDIEAAPPGGEYAAKDYSDPPPAPLFDAEELTKXSL 163 MAKD+E P G + +DY DPPP P FDAEELTK SL Sbjct: 1 MAKDVEG--PDG-FQTRDYEDPPPTPFFDAEELTKWSL 35
>PIP22_ARATH (P43287) Aquaporin PIP2.2 (Plasma membrane intrinsic protein 2b)| (PIP2b) (TMP2b) Length = 285 Score = 46.6 bits (109), Expect = 2e-05 Identities = 23/38 (60%), Positives = 27/38 (71%) Frame = +2 Query: 50 MAKDIEAAPPGGEYAAKDYSDPPPAPLFDAEELTKXSL 163 MAKD+E P G + +DY DPPP P FDA+ELTK SL Sbjct: 1 MAKDVEG-PEG--FQTRDYEDPPPTPFFDADELTKWSL 35
>PIP21_ARATH (P43286) Aquaporin PIP2.1 (Plasma membrane intrinsic protein 2a)| (PIP2a) Length = 287 Score = 44.7 bits (104), Expect = 7e-05 Identities = 21/37 (56%), Positives = 24/37 (64%) Frame = +2 Query: 50 MAKDIEAAPPGGEYAAKDYSDPPPAPLFDAEELTKXS 160 MAKD+EA P G + +DY DPPPAP D EL K S Sbjct: 1 MAKDVEAVPGEG-FQTRDYQDPPPAPFIDGAELKKWS 36
>PIP24_ARATH (Q9FF53) Probable aquaporin PIP2.4 (Plasma membrane intrinsic| protein 2.4) Length = 291 Score = 44.7 bits (104), Expect = 7e-05 Identities = 24/41 (58%), Positives = 27/41 (65%), Gaps = 3/41 (7%) Frame = +2 Query: 50 MAKDI---EAAPPGGEYAAKDYSDPPPAPLFDAEELTKXSL 163 MAKD+ E+ PP AA+DY DPPPAP FD EEL K L Sbjct: 1 MAKDLDVNESGPP----AARDYKDPPPAPFFDMEELRKWPL 37
>PIP25_ARATH (Q9SV31) Probable aquaporin PIP2.5 (Plasma membrane intrinsic| protein 2d) (PIP2d) Length = 286 Score = 38.5 bits (88), Expect = 0.005 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = +2 Query: 89 YAAKDYSDPPPAPLFDAEELTKXS 160 ++ KDY DPPP PLFDA EL K S Sbjct: 12 FSGKDYQDPPPEPLFDATELGKWS 35
>PIP24_ORYSA (Q8GRT8) Aquaporin PIP2.4 (Plasma membrane intrinsic protein 2.4)| (OsPIP2.4) Length = 286 Score = 38.5 bits (88), Expect = 0.005 Identities = 19/35 (54%), Positives = 22/35 (62%) Frame = +2 Query: 59 DIEAAPPGGEYAAKDYSDPPPAPLFDAEELTKXSL 163 D+ GG A+DY DPPPAPL D +EL K SL Sbjct: 6 DVSTLEAGG---ARDYIDPPPAPLVDVDELGKWSL 37
>PIP28_ORYSA (Q7Y1E6) Probable aquaporin PIP2.8 (Plasma membrane intrinsic| protein 2.8) (OsPIP2.8) Length = 280 Score = 37.4 bits (85), Expect = 0.011 Identities = 19/32 (59%), Positives = 19/32 (59%) Frame = +2 Query: 68 AAPPGGEYAAKDYSDPPPAPLFDAEELTKXSL 163 AA G KDY DPPPAPL D EL K SL Sbjct: 2 AAGSGSGSNPKDYQDPPPAPLVDTGELGKWSL 33
>PIP26_ORYSA (Q7XLR1) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2.6) (OsPIP2.6) Length = 282 Score = 37.0 bits (84), Expect = 0.015 Identities = 17/33 (51%), Positives = 21/33 (63%) Frame = +2 Query: 50 MAKDIEAAPPGGEYAAKDYSDPPPAPLFDAEEL 148 M+K++ P KDY+DPPPAPLFD EL Sbjct: 1 MSKEVSEEPE--HVRPKDYTDPPPAPLFDVGEL 31
>PIP25_ORYSA (Q8GRI8) Aquaporin PIP2.5 (Plasma membrane intrinsic protein 2.5)| (OsPIP2.5) Length = 283 Score = 35.4 bits (80), Expect = 0.043 Identities = 19/35 (54%), Positives = 23/35 (65%) Frame = +2 Query: 59 DIEAAPPGGEYAAKDYSDPPPAPLFDAEELTKXSL 163 D+EA GG +DY DPPPAPL D +EL + SL Sbjct: 6 DVEA---GG---VRDYEDPPPAPLVDIDELGRWSL 34
>PIP2_PEA (P25794) Probable aquaporin PIP-type 7a (Turgor-responsive protein| 7a) (Turgor-responsive protein 31) Length = 289 Score = 35.0 bits (79), Expect = 0.056 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = +2 Query: 98 KDYSDPPPAPLFDAEELTKXS 160 KDY +PPPAPLF+ ELT S Sbjct: 32 KDYQEPPPAPLFEPSELTSWS 52
>PIP27_ORYSA (Q651D5) Probable aquaporin PIP2.7 (Plasma membrane intrinsic| protein 2.7) (OsPIP2.7) Length = 290 Score = 35.0 bits (79), Expect = 0.056 Identities = 19/29 (65%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = +2 Query: 80 GGEYAAK-DYSDPPPAPLFDAEELTKXSL 163 GG AAK Y DPPPAPL D EL K SL Sbjct: 14 GGAAAAKAPYWDPPPAPLLDTSELGKWSL 42
>PIP27_ARATH (P93004) Aquaporin PIP2.7 (Plasma membrane intrinsic protein 3)| (Salt stress-induced major intrinsic protein) Length = 280 Score = 34.7 bits (78), Expect = 0.073 Identities = 16/32 (50%), Positives = 18/32 (56%) Frame = +2 Query: 65 EAAPPGGEYAAKDYSDPPPAPLFDAEELTKXS 160 E + G + KDY DPPPAPL D EL S Sbjct: 4 EVSEEGKTHHGKDYVDPPPAPLLDMGELKSWS 35
>PIP13_ORYSA (Q9SXF8) Aquaporin PIP 1.3 (Plasma membrane intrinsic protein 1.3)| (OsPIP1.3) (Water channel protein RWC3) (RWC-3) Length = 288 Score = 33.9 bits (76), Expect = 0.12 Identities = 18/38 (47%), Positives = 22/38 (57%) Frame = +2 Query: 47 TMAKDIEAAPPGGEYAAKDYSDPPPAPLFDAEELTKXS 160 T + I A G E KDY +PP AP+F+ EELT S Sbjct: 16 TERQPIGTAAQGAE--EKDYREPPAAPVFEVEELTSWS 51
>PIP1_ATRCA (P42767) Aquaporin PIP-type| Length = 282 Score = 33.1 bits (74), Expect = 0.21 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +2 Query: 50 MAKDIEAAPPGGEYAAKDYSDPPPAPLFDAEEL 148 M+K++ + KDY DPPPAP FD EL Sbjct: 1 MSKEVISEEGQVHQHGKDYVDPPPAPFFDMGEL 33
>PIP1_LYCES (Q08451) Probable aquaporin PIP-type pTOM75 (Ripening-associated| membrane protein) (RAMP) Length = 286 Score = 32.7 bits (73), Expect = 0.28 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +2 Query: 98 KDYSDPPPAPLFDAEELTKXS 160 KDY +PPPAPLF+ EL+ S Sbjct: 30 KDYKEPPPAPLFEPGELSSWS 50
>PIP14_ARATH (Q39196) Probable aquaporin PIP1.4 (Plasma membrane intrinsic| protein 1.4) (Transmembrane protein C) (TMP-C) Length = 287 Score = 32.7 bits (73), Expect = 0.28 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +2 Query: 98 KDYSDPPPAPLFDAEELTKXS 160 KDY +PPPAPLF+ EL+ S Sbjct: 30 KDYKEPPPAPLFEPGELSSWS 50
>PIP12_ARATH (Q06611) Aquaporin PIP1.2 (Plasma membrane intrinsic protein 1b)| (PIP1b) (Transmembrane protein A) (TMP-A) (AthH2) Length = 286 Score = 32.3 bits (72), Expect = 0.36 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +2 Query: 98 KDYSDPPPAPLFDAEELTKXS 160 KDY +PPPAPLF+ EL S Sbjct: 29 KDYKEPPPAPLFEPGELASWS 49
>PIP11_ORYSA (Q6EU94) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (OsPIP1.1) (Water channel protein RWC1) (RWC-1) Length = 289 Score = 32.0 bits (71), Expect = 0.47 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +2 Query: 98 KDYSDPPPAPLFDAEELTKXS 160 KDY +PPPAPLF+ EL S Sbjct: 32 KDYKEPPPAPLFEPGELKSWS 52
>PIP28_ARATH (Q9ZVX8) Probable aquaporin PIP2.8 (Plasma membrane intrinsic| protein 3b) (PIP3b) Length = 278 Score = 32.0 bits (71), Expect = 0.47 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +2 Query: 98 KDYSDPPPAPLFDAEEL 148 KDY DPPPAPL D EL Sbjct: 13 KDYVDPPPAPLLDMAEL 29
>PIP13_ARATH (Q08733) Aquaporin PIP1.3 (Plasma membrane intrinsic protein 1c)| (PIP1c) (Transmembrane protein B) (TMP-B) Length = 286 Score = 31.2 bits (69), Expect = 0.81 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 98 KDYSDPPPAPLFDAEELTKXS 160 KDY +PPPAP F+ EL+ S Sbjct: 29 KDYKEPPPAPFFEPGELSSWS 49
>PIP11_VICFA (P61838) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (Aquaporin 1) (Plasma membrane aquaporin 1) Length = 286 Score = 31.2 bits (69), Expect = 0.81 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 98 KDYSDPPPAPLFDAEELTKXS 160 KDY +PPPAP F+ EL+ S Sbjct: 29 KDYKEPPPAPFFEPGELSSWS 49
>PIP11_ARATH (P61837) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (Aquaporin 1) (Plasma membrane aquaporin 1) Length = 286 Score = 31.2 bits (69), Expect = 0.81 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 98 KDYSDPPPAPLFDAEELTKXS 160 KDY +PPPAP F+ EL+ S Sbjct: 29 KDYKEPPPAPFFEPGELSSWS 49
>PIP15_ARATH (Q8LAA6) Probable aquaporin PIP1.5 (Plasma membrane intrinsic| protein 1d) (PIP1d) Length = 287 Score = 31.2 bits (69), Expect = 0.81 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +2 Query: 41 GATMAKDIEAAPPGGEYAAKDYSDPPPAPLFDAEELTKXS 160 GA + + + +KDY +PPPAP F+ EL S Sbjct: 11 GANKFPERQPIGTAAQTESKDYKEPPPAPFFEPGELKSWS 50
>PIP26_ARATH (Q9ZV07) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2e) (PIP2e) Length = 289 Score = 29.6 bits (65), Expect = 2.3 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +2 Query: 92 AAKDYSDPPPAPLFDAEELTKXS 160 + KDY DPPP F+ EL K S Sbjct: 13 SGKDYLDPPPVKTFEVRELKKWS 35
>SEM6C_HUMAN (Q9H3T2) Semaphorin-6C precursor (Semaphorin Y) (Sema Y)| Length = 930 Score = 28.9 bits (63), Expect = 4.0 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -3 Query: 79 GWRRLDVLGHRRPPXPIDKVPAXG 8 G RRL GHR PP + +VP+ G Sbjct: 848 GGRRLPFSGHRAPPALLTRVPSGG 871
>PK1L1_HUMAN (Q8TDX9) Polycystic kidney disease 1-like 1 protein (Polycystin-1L1)| Length = 2849 Score = 28.1 bits (61), Expect = 6.8 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 65 EAAPPGGEYAAKDYSDPPPAPLFDAEE 145 EA P GG AKD S P P AEE Sbjct: 1079 EAIPSGGRQPAKDTSFPGSGPSLSAEE 1105
>GAG_SIVG1 (Q02843) Gag polyprotein [Contains: Core protein p17; Core protein| p24; Core protein p15] Length = 513 Score = 27.7 bits (60), Expect = 8.9 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +2 Query: 20 HLVDRXRGATMAKDIEAAPPGGE 88 HLVD+ A K+ APPGGE Sbjct: 109 HLVDKNEKAAKKKNETTAPPGGE 131 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,587,785 Number of Sequences: 219361 Number of extensions: 156251 Number of successful extensions: 744 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 713 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 739 length of database: 80,573,946 effective HSP length: 30 effective length of database: 73,993,116 effective search space used: 1775834784 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)