| Clone Name | baal23a03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | XYLX_PSEPU (P23099) Toluate 1,2-dioxygenase alpha subunit (EC 1.... | 32 | 1.1 | 2 | VNCS_PAVPN (P18547) Noncapsid protein NS-1 (Nonstructural protei... | 30 | 7.3 | 3 | VNCS_PAVPK (P52502) Noncapsid protein NS-1 (Nonstructural protei... | 30 | 7.3 |
|---|
>XYLX_PSEPU (P23099) Toluate 1,2-dioxygenase alpha subunit (EC 1.14.12.-)| Length = 454 Score = 32.3 bits (72), Expect = 1.1 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +2 Query: 2 RQGKSNGWLYTCSFYSHRLCSLALFDEATSPCSFHGMT 115 + G+ N ++ CS LC ++AT CSFHG T Sbjct: 81 KDGELNAFVNACSHRGATLCRFRSGNKATHTCSFHGWT 118
>VNCS_PAVPN (P18547) Noncapsid protein NS-1 (Nonstructural protein NS1)| Length = 660 Score = 29.6 bits (65), Expect = 7.3 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 508 SSWDLLLNYCTPWLLPTKNFTNLSTCXCF 594 +++DL+L P +LPT N +N TC F Sbjct: 338 TAYDLILEKAKPSMLPTFNISNTRTCKIF 366
>VNCS_PAVPK (P52502) Noncapsid protein NS-1 (Nonstructural protein NS1)| Length = 662 Score = 29.6 bits (65), Expect = 7.3 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 508 SSWDLLLNYCTPWLLPTKNFTNLSTCXCF 594 +++DL+L P +LPT N +N TC F Sbjct: 338 TAYDLILEKAKPSMLPTFNISNTRTCKIF 366 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 94,790,429 Number of Sequences: 219361 Number of extensions: 2034181 Number of successful extensions: 5659 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5323 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5654 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5538924943 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)