ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | baal22h08 |
|---|---|
| Clone Library Name | barley_pub |
>MSHR_CEBPY (Q864I0) Melanocyte-stimulating hormone receptor (MSH-R)| (Melanotropin receptor) (Melanocortin receptor 1) (MC1-R) Length = 344 Score = 27.7 bits (60), Expect = 7.5 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 150 TLDLCPFVFYMPYVLXFVXSTFACFVPXHLLCDCL 46 TL + +F++ + F+ T F P HL C+C+ Sbjct: 242 TLTILLGIFFLCWGPFFLHLTLVVFCPQHLTCNCI 276
>MSHR_CALJA (Q864H7) Melanocyte-stimulating hormone receptor (MSH-R)| (Melanotropin receptor) (Melanocortin receptor 1) (MC1-R) Length = 344 Score = 27.7 bits (60), Expect = 7.5 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 150 TLDLCPFVFYMPYVLXFVXSTFACFVPXHLLCDCL 46 TL + +F++ + F+ T F P HL C+C+ Sbjct: 242 TLTILLGIFFLCWGPFFLHLTLVVFCPQHLTCNCI 276
>MSHR_CALGE (Q864H8) Melanocyte-stimulating hormone receptor (MSH-R)| (Melanotropin receptor) (Melanocortin receptor 1) (MC1-R) Length = 344 Score = 27.7 bits (60), Expect = 7.5 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 150 TLDLCPFVFYMPYVLXFVXSTFACFVPXHLLCDCL 46 TL + +F++ + F+ T F P HL C+C+ Sbjct: 242 TLTILLGIFFLCWGPFFLHLTLVVFCPQHLTCNCI 276
>MSHR_CALAR (Q864H9) Melanocyte-stimulating hormone receptor (MSH-R)| (Melanotropin receptor) (Melanocortin receptor 1) (MC1-R) Length = 344 Score = 27.7 bits (60), Expect = 7.5 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 150 TLDLCPFVFYMPYVLXFVXSTFACFVPXHLLCDCL 46 TL + +F++ + F+ T F P HL C+C+ Sbjct: 242 TLTILLGIFFLCWGPFFLHLTLVVFCPQHLTCNCI 276
>MSHR_LEOCY (Q864I1) Melanocyte-stimulating hormone receptor (MSH-R)| (Melanotropin receptor) (Melanocortin receptor 1) (MC1-R) Length = 310 Score = 27.7 bits (60), Expect = 7.5 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 150 TLDLCPFVFYMPYVLXFVXSTFACFVPXHLLCDCL 46 TL + +F++ + F+ T F P HL C+C+ Sbjct: 234 TLTILLGIFFLCWGPFFLRLTLVVFCPQHLTCNCI 268
>MSHR_SAGGE (Q864H3) Melanocyte-stimulating hormone receptor (MSH-R)| (Melanotropin receptor) (Melanocortin receptor 1) (MC1-R) Length = 316 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -3 Query: 150 TLDLCPFVFYMPYVLXFVXSTFACFVPXHLLCDCL 46 TL + +F++ + F+ T F P HL C C+ Sbjct: 242 TLTILLGIFFLCWGPFFLHLTLVVFCPQHLTCSCI 276
>MSHR_SAGFU (Q864H4) Melanocyte-stimulating hormone receptor (MSH-R)| (Melanotropin receptor) (Melanocortin receptor 1) (MC1-R) Length = 316 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -3 Query: 150 TLDLCPFVFYMPYVLXFVXSTFACFVPXHLLCDCL 46 TL + +F++ + F+ T F P HL C C+ Sbjct: 242 TLTILLGIFFLCWGPFFLHLTLVVFCPQHLTCSCI 276
>MSHR_CEBAL (Q864G9) Melanocyte-stimulating hormone receptor (MSH-R)| (Melanotropin receptor) (Melanocortin receptor 1) (MC1-R) Length = 316 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -3 Query: 150 TLDLCPFVFYMPYVLXFVXSTFACFVPXHLLCDCL 46 TL + +F++ + F+ T F P HL C C+ Sbjct: 241 TLTILLGIFFLCWGPFFLHLTLVVFCPQHLTCSCI 275
>MSHR_SAGOE (Q864H2) Melanocyte-stimulating hormone receptor (MSH-R)| (Melanotropin receptor) (Melanocortin receptor 1) (MC1-R) Length = 317 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -3 Query: 150 TLDLCPFVFYMPYVLXFVXSTFACFVPXHLLCDCL 46 TL + +F++ + F+ T F P HL C C+ Sbjct: 242 TLTILLGIFFLCWGPFFLHLTLVVFCPQHLTCSCI 276
>MSHR_SAGMI (Q864H1) Melanocyte-stimulating hormone receptor (MSH-R)| (Melanotropin receptor) (Melanocortin receptor 1) (MC1-R) Length = 317 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -3 Query: 150 TLDLCPFVFYMPYVLXFVXSTFACFVPXHLLCDCL 46 TL + +F++ + F+ T F P HL C C+ Sbjct: 242 TLTILLGIFFLCWGPFFLHLTLVVFCPQHLTCSCI 276
>MSHR_SAGIM (Q864H5) Melanocyte-stimulating hormone receptor (MSH-R)| (Melanotropin receptor) (Melanocortin receptor 1) (MC1-R) Length = 317 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -3 Query: 150 TLDLCPFVFYMPYVLXFVXSTFACFVPXHLLCDCL 46 TL + +F++ + F+ T F P HL C C+ Sbjct: 242 TLTILLGIFFLCWGPFFLHLTLVVFCPQHLTCSCI 276
>MSHR_LEORO (Q864I3) Melanocyte-stimulating hormone receptor (MSH-R)| (Melanotropin receptor) (Melanocortin receptor 1) (MC1-R) Length = 318 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 150 TLDLCPFVFYMPYVLXFVXSTFACFVPXHLLCDCL 46 TL + +F++ + F+ T F P HL C+C+ Sbjct: 242 TLTILLGIFFLCWGPFFLCLTLVVFCPQHLTCNCI 276
>MSHR_LEOCH (Q864I2) Melanocyte-stimulating hormone receptor (MSH-R)| (Melanotropin receptor) (Melanocortin receptor 1) (MC1-R) Length = 318 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 150 TLDLCPFVFYMPYVLXFVXSTFACFVPXHLLCDCL 46 TL + +F++ + F+ T F P HL C+C+ Sbjct: 242 TLTILLGIFFLCWGPFFLCLTLVVFCPQHLTCNCI 276 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,176,180 Number of Sequences: 219361 Number of extensions: 582412 Number of successful extensions: 1348 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1321 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1345 length of database: 80,573,946 effective HSP length: 85 effective length of database: 61,928,261 effective search space used: 1486278264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
